• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004369 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $2448.00 $2399.00 24

*Business Day

Related Services

RefSeq Version NM_004369.3, 190343014
Length 10599 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 1, mRNA.
Product collagen alpha-3(VI) chain isoform 1 precursor
Comment

Summary: This gene encodes the alpha-3 chain, one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The alpha-3 chain of type VI collagen is much larger than the alpha-1 and -2 chains. This difference in size is largely due to an increase in the number of subdomains, similar to von Willebrand Factor type A domains, that are found in the amino terminal globular domain of all the alpha chains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in the type VI collagen genes are associated with Bethlem myopathy, a rare autosomal dominant proximal myopathy with early childhood onset. Mutations in this gene are also a cause of Ullrich congenital muscular dystrophy, also referred to as Ullrich scleroatonic muscular dystrophy, an autosomal recessive congenital myopathy that is more severe than Bethlem myopathy. Multiple transcript variants have been identified, but the full-length nature of only some of these variants has been described. [provided by RefSeq, Jun 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the full-length isoform (1).

RefSeq NP_004360.2
CDS 286..9819
Misc Feature(1)31
Misc Feature(2)31
Misc Feature(3)211..213
Misc Feature(4)361..6399
Misc Feature(5)361..363
Misc Feature(6)397..894
Misc Feature(7)order(418..420,631..633,736..738)
Misc Feature(8)1006..1500
Misc Feature(9)order(1027..1029,1243..1245,1348..1350)
Misc Feature(10)1582..1584
Misc Feature(11)1615..2109
Misc Feature(12)order(1636..1638,1642..1644,1648..1650)
Misc Feature(13)order(1642..1650,1654..1656,1852..1854)
Misc Feature(14)2197..2691
Misc Feature(15)order(2218..2220,2224..2226,2230..2232)
Misc Feature(16)order(2224..2232,2236..2238,2434..2436)
Misc Feature(17)2791..3282
Misc Feature(18)order(2812..2814,3025..3027,3130..3132)
Misc Feature(19)3367..3858
Misc Feature(20)order(3388..3390,3601..3603,3706..3708)
Misc Feature(21)3979..4467
Misc Feature(22)order(4000..4002,4006..4008,4012..4014)
Misc Feature(23)order(4006..4014,4018..4020,4213..4215)
Misc Feature(24)4588..5082
Misc Feature(25)order(4609..4611,4615..4617,4621..4623)
Misc Feature(26)order(4615..4623,4627..4629,4825..4827)
Misc Feature(27)5197..5688
Misc Feature(28)order(5218..5220,5440..5442,5539..5541)
Misc Feature(29)5797..6267
Misc Feature(30)order(5815..5817,6055..6057,6142..6144)
Misc Feature(31)6400..7410
Misc Feature(32)6403..6411
Misc Feature(33)6523..6684
Misc Feature(34)6583..6585
Misc Feature(35)6592..6594
Misc Feature(36)6613..6801
Misc Feature(37)6691..6699
Misc Feature(38)6727..6735
Misc Feature(39)6745..6753
Misc Feature(40)6832..7161
Misc Feature(41)6901..6903
Misc Feature(42)6910..6912
Misc Feature(43)6919..6921
Misc Feature(44)7000..7002
Misc Feature(45)7093..7299
Misc Feature(46)7225..7398
Misc Feature(47)7231..7233
Misc Feature(48)7240..7242
Misc Feature(49)7249..7251
Misc Feature(50)7294..7296
Misc Feature(51)7393..7401
Misc Feature(52)7411..9816
Misc Feature(53)7492..7914
Misc Feature(54)order(7492..7494,7555..7557,7816..7818,7822..7824,
Misc Feature(55)order(7507..7509,7513..7515,7519..7521,7738..7740,
Misc Feature(56)order(7513..7521,7525..7527,7738..7740)
Misc Feature(57)order(7615..7617,7660..7665,7696..7701)
Misc Feature(58)order(7642..7647,7651..7653,7750..7752,7759..7761,
Misc Feature(59)8137..8670
Misc Feature(60)order(8137..8139,8143..8145,8206..8208,8497..8499,
Misc Feature(61)order(8158..8160,8164..8166,8170..8172,8515..8517)
Misc Feature(62)order(8164..8172,8176..8178)
Misc Feature(63)order(8272..8274,8347..8352,8383..8388)
Misc Feature(64)order(8299..8301,8332..8334,8338..8340,8434..8436,
Misc Feature(65)9262..9468
Misc Feature(66)9613..9771
Misc Feature(67)order(9643..9657,9661..9663)
Misc Feature(68)9649..9654
Exon (1)1..255
Gene:COL6A3
Gene Synonym:COL6A3
Exon (2)256..376
Gene:COL6A3
Gene Synonym:COL6A3
Exon (3)377..994
Gene:COL6A3
Gene Synonym:COL6A3
Exon (4)995..1597
Gene:COL6A3
Gene Synonym:COL6A3
Exon (5)1598..2182
Gene:COL6A3
Gene Synonym:COL6A3
Exon (6)2183..2782
Gene:COL6A3
Gene Synonym:COL6A3
Exon (7)2783..3355
Gene:COL6A3
Gene Synonym:COL6A3
Exon (8)3356..3964
Gene:COL6A3
Gene Synonym:COL6A3
Exon (9)3965..4570
Gene:COL6A3
Gene Synonym:COL6A3
Exon (10)4571..5185
Gene:COL6A3
Gene Synonym:COL6A3
Exon (11)5186..5785
Gene:COL6A3
Gene Synonym:COL6A3
Exon (12)5786..6123
Gene:COL6A3
Gene Synonym:COL6A3
Exon (13)6124..6202
Gene:COL6A3
Gene Synonym:COL6A3
Exon (14)6203..6348
Gene:COL6A3
Gene Synonym:COL6A3
Exon (15)6349..6441
Gene:COL6A3
Gene Synonym:COL6A3
Exon (16)6442..6495
Gene:COL6A3
Gene Synonym:COL6A3
Exon (17)6496..6567
Gene:COL6A3
Gene Synonym:COL6A3
Exon (18)6568..6594
Gene:COL6A3
Gene Synonym:COL6A3
Exon (19)6595..6639
Gene:COL6A3
Gene Synonym:COL6A3
Exon (20)6640..6693
Gene:COL6A3
Gene Synonym:COL6A3
Exon (21)6694..6756
Gene:COL6A3
Gene Synonym:COL6A3
Exon (22)6757..6822
Gene:COL6A3
Gene Synonym:COL6A3
Exon (23)6823..6876
Gene:COL6A3
Gene Synonym:COL6A3
Exon (24)6877..6912
Gene:COL6A3
Gene Synonym:COL6A3
Exon (25)6913..6975
Gene:COL6A3
Gene Synonym:COL6A3
Exon (26)6976..7038
Gene:COL6A3
Gene Synonym:COL6A3
Exon (27)7039..7101
Gene:COL6A3
Gene Synonym:COL6A3
Exon (28)7102..7164
Gene:COL6A3
Gene Synonym:COL6A3
Exon (29)7165..7215
Gene:COL6A3
Gene Synonym:COL6A3
Exon (30)7216..7251
Gene:COL6A3
Gene Synonym:COL6A3
Exon (31)7252..7314
Gene:COL6A3
Gene Synonym:COL6A3
Exon (32)7315..7377
Gene:COL6A3
Gene Synonym:COL6A3
Exon (33)7378..7410
Gene:COL6A3
Gene Synonym:COL6A3
Exon (34)7411..7447
Gene:COL6A3
Gene Synonym:COL6A3
Exon (35)7448..7459
Gene:COL6A3
Gene Synonym:COL6A3
Exon (36)7460..7953
Gene:COL6A3
Gene Synonym:COL6A3
Exon (37)7954..8050
Gene:COL6A3
Gene Synonym:COL6A3
Exon (38)8051..8749
Gene:COL6A3
Gene Synonym:COL6A3
Exon (39)8750..8852
Gene:COL6A3
Gene Synonym:COL6A3
Exon (40)8853..9250
Gene:COL6A3
Gene Synonym:COL6A3
Exon (41)9251..9514
Gene:COL6A3
Gene Synonym:COL6A3
Exon (42)9515..9613
Gene:COL6A3
Gene Synonym:COL6A3
Exon (43)9614..9778
Gene:COL6A3
Gene Synonym:COL6A3
Exon (44)9779..10581
Gene:COL6A3
Gene Synonym:COL6A3
Translation MRKHRHLPLVAVFCLFLSGFPTTHAQQQQADVKNGAAADIIFLVDSSWTIGEEHFQLVRE FLYDVVKSLAVGENDFHFALVQFNGNPHTEFLLNTYRTKQEVLSHISNMSYIGGTNQTGK GLEYIMQSHLTKAAGSRAGDGVPQVIVVLTDGHSKDGLALPSAELKSADVNVFAIGVEDA DEGALKEIASEPLNMHMFNLENFTSLHDIVGNLVSCVHSSVSPERAGDTETLKDITAQDS ADIIFLIDGSNNTGSVNFAVILDFLVNLLEKLPIGTQQIRVGVVQFSDEPRTMFSLDTYS TKAQVLGAVKALGFAGGELANIGLALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSD EIRYGVVALKQASVFSFGLGAQAASRAELQHIATDDNLVFTVPEFRSFGDLQEKLLPYIV GVAQRHIVLKPPTIVTQVIEVNKRDIVFLVDGSSALGLANFNAIRDFIAKVIQRLEIGQD LIQVAVAQYADTVRPEFYFNTHPTKREVITAVRKMKPLDGSALYTGSALDFVRNNLFTSS AGYRAAEGIPKLLVLITGGKSLDEISQPAQELKRSSIMAFAIGNKGADQAELEEIAFDSS LVFIPAEFRAAPLQGMLPGLLAPLRTLSGTPEVHSNKRDIIFLLDGSANVGKTNFPYVRD FVMNLVNSLDIGNDNIRVGLVQFSDTPVTEFSLNTYQTKSDILGHLRQLQLQGGSGLNTG SALSYVYANHFTEAGGSRIREHVPQLLLLLTAGQSEDSYLQAANALTRAGILTFCVGASQ ANKAELEQIAFNPSLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILF LFDGSANLVGQFPVVRDFLYKIIDELNVKPEGTRIAVAQYSDDVKVESRFDEHQSKPEIL NLVKRMKIKTGKALNLGYALDYAQRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPA SNLKQSGVVPFIFQAKNADPAELEQIVLSPAFILAAESLPKIGDLHPQIVNLLKSVHNGA PAPVSGEKDVVFLLDGSEGVRSGFPLLKEFVQRVVESLDVGQDRVRVAVVQYSDRTRPEF YLNSYMNKQDVVNAVRQLTLLGGPTPNTGAALEFVLRNILVSSAGSRITEGVPQLLIVLT ADRSGDDVRNPSVVVKRGGAVPIGIGIGNADITEMQTISFIPDFAVAIPTFRQLGTVQQV ISERVTQLTREELSRLQPVLQPLPSPGVGGKRDVVFLIDGSQSAGPEFQYVRTLIERLVD YLDVGFDTTRVAVIQFSDDPKVEFLLNAHSSKDEVQNAVQRLRPKGGRQINVGNALEYVS RNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVDDPAVELKQFGVAPFTIARNADQEELVK ISLSPEYVFSVSTFRELPSLEQKLLTPITTLTSEQIQKLLASTRYPPPAVESDAADIVFL IDSSEGVRPDGFAHIRDFVSRIVRRLNIGPSKVRVGVVQFSNDVFPEFYLKTYRSQAPVL DAIRRLRLRGGSPLNTGKALEFVARNLFVKSAGSRIEDGVPQHLVLVLGGKSQDDVSRFA QVIRSSGIVSLGVGDRNIDRTELQTITNDPRLVFTVREFRELPNIEERIMNSFGPSAATP APPGVDTPPPSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGL VQYNSDPTDEFFLKDFSTKRQIIDAINKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLD QRVPQIAFVITGGKSVEDAQDVSLALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVG NVQELSELSEQVLETLHDAMHETLCPGVTDAAKACNLDVILGFDGSRDQNVFVAQKGFES KVDAILNRISQMHRVSCSGGRSPTVRVSVVANTPSGPVEAFDFDEYQPEMLEKFRNMRSQ HPYVLTEDTLKVYLNKFRQSSPDSVKVVIHFTDGADGDLADLHRASENLRQEGVRALILV GLERVVNLERLMHLEFGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGQR GDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFP GEKGEVGEIGLDGLDGEDGDKGLPGSSGEKGNPGRRGDKGPRGEKGERGDVGIRGDPGNP GQDSQERGPKGETGDLGPMGVPGRDGVPGGPGETGKNGGFGRRGPPGAKGNKGGPGQPGF EGEQGTRGAQGPAGPAGPPGLIGEQGISGPRGSGGAAGAPGERGRTGPLGRKGEPGEPGP KGGIGNRGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGNPGEPGLNGTTGPKGIR GRRGNSGPPGIVGQKGDPGYPGPAGPKGNRGDSIDQCALIQSIKDKCPCCYGPLECPVFP TELAFALDTSEGVNQDTFGRMRDVVLSIVNDLTIAESNCPRGARVAVVTYNNEVTTEIRF ADSKRKSVLLDKIKNLQVALTSKQQSLETAMSFVARNTFKRVRNGFLMRKVAVFFSNTPT RASPQLREAVLKLSDAGITPLFLTRQEDRQLINALQINNTAVGHALVLPAGRDLTDFLEN VLTCHVCLDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDMAFILDSAETTTLFQFNEMKK YIAYLVRQLDMSPDPKASQHFARVAVVQHAPSESVDNASMPPVKVEFSLTDYGSKEKLVD FLSRGMTQLQGTRALGSAIEYTIENVFESAPNPRDLKIVVLMLTGEVPEQQLEEAQRVIL QAKCKGYFFVVLGIGRKVNIKEVYTFASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFV SSENAFYLSPDIRKQCDWFQGDQPTKNLVKFGHKQVNVPNNVTSSPTSNPVTTTKPVTTT KPVTTTTKPVTTTTKPVTIINQPSVKPAAAKPAPAKPVAAKPVATKMATVRPPVAVKPAT AAKPVAAKPAAVRPPAAAAAKPVATKPEVPRPQAAKPAATKPATTKPMVKMSREVQVFEI TENSAKLHWERAEPPGPYFYDLTVTSAHDQSLVLKQNLTVTDRVIGGLLAGQTYHVAVVC YLRSQVRATYHGSFSTKKSQPPPPQPARSASSSTINLMVSTEPLALTETDICKLPKDEGT CRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(122)-c, adbSNP:78466992
139+a, gdbSNP:113567254
complement(274)-dbSNP:
complement(274)-g, cdbSNP:371342713
complement(307)-g, cdbSNP:144189491
complement(319)-t, cdbSNP:137910388
complement(326)-c, adbSNP:74894716
complement(330)-g, cdbSNP:376767547
359+a, cdbSNP:398124134
complement(374)-g, cdbSNP:371046481
complement(393)-dbSNP:
complement(393)-t, cdbSNP:374055173
complement(403)-t, cdbSNP:370368996
complement(431)-g, adbSNP:200025389
complement(439)-t, cdbSNP:188510971
460+c, tdbSNP:398124119
461+a, gdbSNP:111577719
complement(467)-g, adbSNP:375649083
complement(482)-g, adbSNP:113347765
complement(487)-c, adbSNP:372628119
complement(503)-t, cdbSNP:138570455
complement(535)-t, cdbSNP:112765805
complement(539)-t, cdbSNP:369814614
complement(545)-g, cdbSNP:200887514
complement(570)-t, cdbSNP:373435541
complement(574)-g, adbSNP:144651558
complement(575)-t, cdbSNP:201249839
complement(577)-t, adbSNP:76646066
complement(620)-g, adbSNP:375590099
complement(630)-t, gdbSNP:371958092
complement(657)-t, gdbSNP:201306056
complement(658)-t, adbSNP:368077444
complement(694)-g, adbSNP:143819673
complement(699)-g, adbSNP:148996231
706+a, gdbSNP:398124120
complement(746)-g, adbSNP:147701785
complement(751)-c, adbSNP:199632952
complement(752)-t, gdbSNP:150972216
complement(763)-g, adbSNP:200483815
complement(773)-g, adbSNP:184538194
complement(774)-t, cdbSNP:148970984
complement(808)-t, cdbSNP:376501805
complement(834)-t, gdbSNP:371801495
complement(861)-c, adbSNP:141560881
complement(890)-t, gdbSNP:145983482
complement(945)-g, adbSNP:368636382
complement(971)-g, adbSNP:141586922
complement(991)-t, cdbSNP:200105833
complement(1015)-dbSNP:
complement(1015)-t, cdbSNP:116729313
complement(1043)-t, gdbSNP:201283466
complement(1044)-g, adbSNP:376087730
complement(1053)-g, adbSNP:79606264
complement(1060)-t, cdbSNP:141609058
complement(1061)-g, adbSNP:149924028
1071+c, tdbSNP:111481402
complement(1089)-g, cdbSNP:372517103
complement(1124)-c, adbSNP:370246962
complement(1128)-c, adbSNP:376201065
complement(1147)-t, cdbSNP:115729513
complement(1167)-g, adbSNP:7561625
complement(1181)-t, cdbSNP:202132584
complement(1205)-t, cdbSNP:149412478
complement(1212)-t, cdbSNP:369957702
complement(1219)-t, gdbSNP:147339080
complement(1221)-g, adbSNP:377629176
complement(1235)-t, cdbSNP:186336512
complement(1243)-t, cdbSNP:115819851
complement(1246)-t, cdbSNP:147027777
complement(1251)-g, adbSNP:369160080
complement(1282)-g, adbSNP:376948716
complement(1291)-g, adbSNP:200720222
complement(1297)-c, adbSNP:369034667
complement(1307)-t, cdbSNP:140510298
1309+a, gdbSNP:111402193
complement(1341)-g, adbSNP:78365682
complement(1348)-t, cdbSNP:375022162
complement(1350)-g, adbSNP:115155458
complement(1351)-t, cdbSNP:200795795
complement(1360)-t, cdbSNP:114235473
complement(1416)-g, adbSNP:189772397
complement(1431)-t, cdbSNP:368800027
complement(1432)-t, cdbSNP:146429448
complement(1434)-g, adbSNP:139016980
complement(1435)-t, cdbSNP:374267444
complement(1449)-t, cdbSNP:115182723
complement(1459)-t, cdbSNP:201106875
complement(1467)-g, adbSNP:114750216
complement(1471)-t, cdbSNP:372071064
complement(1475)-t, cdbSNP:368344827
complement(1494)-t, cdbSNP:373903065
complement(1499)-g, adbSNP:114549120
1501+c, tdbSNP:112817175
complement(1513)-t, cdbSNP:35914491
1516+c, gdbSNP:113716915
complement(1533)-t, cdbSNP:150219857
complement(1549)-t, cdbSNP:114511558
complement(1553)-g, adbSNP:181264679
complement(1560)-t, cdbSNP:370549716
complement(1577)-g, adbSNP:144746928
complement(1578)-t, cdbSNP:376912950
complement(1620)-dbSNP:
complement(1620)-g, adbSNP:202186575
complement(1655)-c, adbSNP:377757978
complement(1658)-t, adbSNP:374134397
complement(1670)-t, cdbSNP:200250810
1674+c, tdbSNP:112896869
1678+c, tdbSNP:121434554
complement(1718)-t, cdbSNP:369412773
1756+c, gdbSNP:112010940
1760+c, gdbSNP:113897824
complement(1763)-g, adbSNP:116794756
complement(1797)-t, cdbSNP:199969722
complement(1815)-g, adbSNP:373281009
complement(1822)-g, cdbSNP:369379463
complement(1823)-t, cdbSNP:139498556
complement(1833)-t, cdbSNP:375813490
complement(1842)-g, adbSNP:145586177
complement(1847)-g, adbSNP:115881121
complement(1856)-t, cdbSNP:147546808
complement(1857)-g, adbSNP:115973206
complement(1898)-g, adbSNP:34741387
complement(1905)-t, cdbSNP:200205650
complement(1908)-g, adbSNP:114144694
complement(1921)-t, cdbSNP:150377792
complement(1923)-g, adbSNP:112040282
complement(1941)-c, adbSNP:141939225
1973+a, gdbSNP:112913396
complement(1987)-t, gdbSNP:371535536
complement(2001)-t, cdbSNP:370085973
complement(2036)-t, cdbSNP:375285237
complement(2046)-g, adbSNP:34978064
complement(2070)-g, adbSNP:114278376
complement(2071)-c, adbSNP:34934127
complement(2076)-g, adbSNP:76576170
complement(2097)-g, adbSNP:138036318
complement(2111)-t, cdbSNP:149330325
complement(2116)-t, cdbSNP:372255458
complement(2118)-g, adbSNP:368242683
complement(2119)-g, cdbSNP:150162992
complement(2152)-g, adbSNP:372022185
complement(2159)-g, cdbSNP:61729841
complement(2191)-dbSNP:
complement(2191)-t, gdbSNP:111379417
complement(2199)-t, cdbSNP:34904623
complement(2221)-t, cdbSNP:140309965
complement(2233)-t, cdbSNP:149187225
complement(2235)-g, adbSNP:112662926
complement(2246)-t, cdbSNP:144501019
complement(2260)-g, adbSNP:146291186
complement(2261)-t, cdbSNP:36092870
complement(2262)-g, adbSNP:141280228
complement(2270)-g, adbSNP:115012632
2281+a, gdbSNP:111584250
complement(2314)-g, adbSNP:137923508
complement(2315)-t, c, adbSNP:35227432
complement(2320)-c, adbSNP:201031137
complement(2340)-g, adbSNP:72986169
complement(2353)-t, cdbSNP:368161217
complement(2361)-c, adbSNP:374296030
complement(2371)-g, adbSNP:370342622
complement(2372)-t, cdbSNP:367690192
complement(2390)-g, adbSNP:141068214
complement(2422)-t, cdbSNP:142160199
complement(2430)-c, adbSNP:375924639
complement(2432)-t, cdbSNP:144514259
complement(2444)-c, adbSNP:371336750
complement(2446)-g, adbSNP:146794191
complement(2447)-g, cdbSNP:377632042
complement(2459)-t, cdbSNP:373247612
2465+a, cdbSNP:113393241
complement(2480)-g, adbSNP:370719148
complement(2490)-g, adbSNP:148713779
complement(2491)-t, cdbSNP:150008830
complement(2503)-g, adbSNP:147182340
complement(2511)-g, adbSNP:376627571
complement(2516)-g, adbSNP:199504304
complement(2517)-t, cdbSNP:368826874
complement(2577)-g, adbSNP:116066149
complement(2587)-g, adbSNP:200722892
complement(2590)-t, cdbSNP:142719863
complement(2627)-g, adbSNP:116753562
complement(2685)-t, adbSNP:374774989
2704+a, gdbSNP:113155945
complement(2711)-g, adbSNP:138281601
complement(2729)-t, gdbSNP:199601240
complement(2748)-g, adbSNP:115387170
complement(2773)-c, adbSNP:77181645
complement(2802)-dbSNP:
complement(2802)-g, cdbSNP:187237497
complement(2808)-g, adbSNP:142876356
complement(2810)-g, adbSNP:369930821
complement(2812)-g, cdbSNP:181006249
complement(2852)-g, cdbSNP:147897225
complement(2856)-g, adbSNP:114094922
complement(2874)-g, adbSNP:376409920
complement(2920)-g, adbSNP:139653464
complement(2942)-t, adbSNP:9630964
complement(2942)-t, adbSNP:386623900
complement(2950)-g, adbSNP:201327438
2951+a, gdbSNP:111295967
complement(2974)-g, cdbSNP:115793808
complement(2980)-t, cdbSNP:372114508
complement(3014)-g, adbSNP:189356869
complement(3015)-t, cdbSNP:367991818
complement(3017)-t, cdbSNP:149310819
complement(3034)-t, cdbSNP:375113417
complement(3039)-g, adbSNP:114492689
complement(3040)-t, cdbSNP:114563217
complement(3041)-g, adbSNP:115327470
complement(3042)-t, c, adbSNP:115874872
complement(3059)-c, adbSNP:372127270
complement(3064)-t, gdbSNP:367585097
3079+a, g, tdbSNP:112827048
complement(3093)-g, adbSNP:116256579
complement(3130)-t, cdbSNP:374960915
3149+a, gdbSNP:112172548
complement(3153)-t, cdbSNP:371220541
complement(3155)-t, cdbSNP:116294003
complement(3187)-t, cdbSNP:202122047
complement(3203)-t, adbSNP:199960342
complement(3204)-g, cdbSNP:368643309
complement(3243)-g, adbSNP:145203676
complement(3244)-t, cdbSNP:140437593
complement(3257)-g, adbSNP:202185764
complement(3306)-t, adbSNP:201085369
complement(3325)-t, cdbSNP:114284669
complement(3338)-t, cdbSNP:375167315
complement(3339)-g, adbSNP:34367758
complement(3340)-t, cdbSNP:370664069
complement(3348)-t, cdbSNP:200098134
complement(3357)-dbSNP:
complement(3357)-t, adbSNP:370514242
3372+c, tdbSNP:113066678
complement(3373)-t, cdbSNP:116238578
complement(3403)-t, cdbSNP:78427077
complement(3411)-g, adbSNP:372619164
complement(3414)-g, adbSNP:12622093
complement(3475)-g, adbSNP:369810455
3476+a, gdbSNP:112638391
complement(3483)-g, adbSNP:200621867
complement(3484)-t, cdbSNP:148175795
complement(3490)-t, cdbSNP:115297652
complement(3508)-t, g, adbSNP:201962257
complement(3543)-g, cdbSNP:148941053
complement(3547)-t, gdbSNP:11896521
3555+c, tdbSNP:113781746
complement(3556)-t, cdbSNP:373915980
complement(3558)-g, adbSNP:200562443
complement(3565)-c, adbSNP:369460632
complement(3571)-g, adbSNP:114852262
complement(3572)-t, cdbSNP:200860322
complement(3596)-g, adbSNP:371991808
complement(3609)-g, adbSNP:116239777
complement(3615)-g, adbSNP:111328076
complement(3616)-t, cdbSNP:151021451
complement(3639)-g, adbSNP:376551239
complement(3653)-g, adbSNP:371843927
complement(3656)-g, adbSNP:374447921
complement(3667)-t, cdbSNP:372844024
complement(3696)-g, adbSNP:368285658
complement(3697)-t, cdbSNP:199964760
complement(3704)-g, adbSNP:201131900
complement(3705)-t, cdbSNP:35489467
complement(3714)-c, adbSNP:146171151
3730+c, tdbSNP:113360085
complement(3731)-t, cdbSNP:36062562
3741+c, tdbSNP:112815265
complement(3760)-g, cdbSNP:146313030
complement(3772)-t, gdbSNP:116567860
complement(3774)-c, adbSNP:370403457
complement(3786)-g, adbSNP:199998363
complement(3792)-g, adbSNP:138426138
complement(3807)-c, adbSNP:376084880
complement(3816)-g, cdbSNP:143705718
complement(3840)-g, adbSNP:373719229
complement(3841)-t, cdbSNP:144976132
complement(3854)-t, gdbSNP:369994205
complement(3861)-g, adbSNP:201942049
complement(3909)-t, gdbSNP:376997896
complement(3914)-t, cdbSNP:373324548
complement(3936)-c, adbSNP:115065877
complement(3938)-g, cdbSNP:75071027
complement(3947)-t, cdbSNP:376409445
complement(3991)-dbSNP:
complement(3991)-g, adbSNP:200615239
complement(3999)-g, adbSNP:150911180
complement(4017)-g, adbSNP:193265138
complement(4018)-t, cdbSNP:150548221
complement(4036)-t, cdbSNP:199646208
complement(4040)-t, cdbSNP:201314411
complement(4072)-t, cdbSNP:376725775
complement(4116)-g, adbSNP:114110705
complement(4122)-t, gdbSNP:372089952
complement(4137)-t, gdbSNP:148561729
complement(4144)-t, adbSNP:35799634
4146+c, tdbSNP:113247852
complement(4164)-t, gdbSNP:386437265
complement(4164)-c, adbSNP:74425496
complement(4168)-t, cdbSNP:143879892
complement(4176)-g, adbSNP:200722316
complement(4186)-g, adbSNP:150430813
complement(4187)-t, cdbSNP:148038440
complement(4207)-g, adbSNP:140330124
complement(4212)-g, cdbSNP:201240081
complement(4217)-t, cdbSNP:200592625
complement(4219)-t, cdbSNP:144878757
complement(4239)-g, adbSNP:375909800
complement(4248)-t, cdbSNP:116531393
complement(4264)-g, cdbSNP:144871366
complement(4285)-t, cdbSNP:149908123
complement(4290)-g, adbSNP:34503558
complement(4291)-t, cdbSNP:144051775
complement(4296)-t, cdbSNP:114498197
complement(4303)-g, adbSNP:138834992
complement(4317)-t, cdbSNP:145048734
complement(4332)-g, adbSNP:115893145
complement(4349)-g, adbSNP:140863092
complement(4351)-t, cdbSNP:143459232
complement(4375)-t, cdbSNP:35524572
complement(4388)-g, adbSNP:116505603
complement(4392)-g, adbSNP:35114079
complement(4393)-c, adbSNP:372234605
complement(4401)-g, adbSNP:369620378
4402+a, gdbSNP:112181324
complement(4431)-t, cdbSNP:114791158
complement(4441)-t, cdbSNP:146092501
complement(4454)-g, adbSNP:115548605
complement(4468)-g, adbSNP:73998894
complement(4469)-t, cdbSNP:80272723
complement(4469)-g, adbSNP:386437377
complement(4502)-g, adbSNP:114061998
complement(4511)-g, adbSNP:368928992
complement(4512)-g, cdbSNP:142938239
complement(4529)-t, cdbSNP:374265497
complement(4542)-g, cdbSNP:145889244
complement(4556)-t, cdbSNP:149838946
complement(4594)-dbSNP:
complement(4594)-t, adbSNP:144314743
4596+c, tdbSNP:2646260
complement(4646)-t, cdbSNP:141754714
complement(4668)-t, cdbSNP:144612879
complement(4676)-t, cdbSNP:138676768
complement(4684)-t, cdbSNP:138049094
complement(4689)-g, adbSNP:371075249
complement(4695..4696)-, gdbSNP:35616486
complement(4696)-t, cdbSNP:150321587
complement(4713)-c, adbSNP:377587428
complement(4716)-g, adbSNP:151289203
complement(4717)-t, cdbSNP:374493032
complement(4721)-t, adbSNP:369449472
complement(4727)-t, cdbSNP:377660056
complement(4733)-t, adbSNP:114736729
complement(4742..4743)-, gdbSNP:34407869
complement(4742)-t, gdbSNP:373597770
complement(4773)-t, cdbSNP:369543806
complement(4778)-g, adbSNP:146629310
complement(4779)-t, cdbSNP:374885393
complement(4788)-g, adbSNP:115551245
complement(4789)-t, cdbSNP:201722265
complement(4795)-g, adbSNP:144223596
complement(4818)-c, adbSNP:2645774
complement(4845)-g, adbSNP:375279488
4846+a, gdbSNP:113538665
complement(4880)-g, adbSNP:372247515
complement(4889)-t, cdbSNP:115765346
complement(4890)-g, adbSNP:369727198
complement(4899)-g, adbSNP:199759398
complement(4912)-g, adbSNP:368231016
complement(4952)-c, adbSNP:375207869
complement(4956)-g, adbSNP:116760648
complement(4962)-g, adbSNP:147215386
complement(4963)-t, cdbSNP:371631320
4968+a, gdbSNP:113074898
complement(4974)-g, cdbSNP:201178064
complement(4975)-t, gdbSNP:200825417
complement(4976)-t, cdbSNP:368151192
complement(5012)-t, cdbSNP:61729839
complement(5025)-t, cdbSNP:112041502
complement(5034)-t, cdbSNP:373686450
5098+a, gdbSNP:111389165
complement(5120)-g, adbSNP:201532239
complement(5123)-g, adbSNP:370253845
complement(5127)-t, cdbSNP:199531763
complement(5133)-g, adbSNP:200948078
complement(5134)-t, g, cdbSNP:200433282
5158+a, gdbSNP:398124121
complement(5165)-t, gdbSNP:149261556
complement(5173)-g, adbSNP:145560772
5179+c, tdbSNP:113755498
5180+a, gdbSNP:111231885
complement(5181)-t, cdbSNP:115320732
complement(5197)-dbSNP:
complement(5197)-t, cdbSNP:114322958
complement(5229)-t, gdbSNP:200764075
complement(5258)-g, adbSNP:377630865
complement(5304)-g, adbSNP:140516220
complement(5308)-g, adbSNP:374247268
5321+a, gdbSNP:121434553
complement(5344)-g, adbSNP:35273032
complement(5352)-t, gdbSNP:370475865
complement(5353)-t, cdbSNP:144451523
complement(5364)-t, cdbSNP:114553632
complement(5369)-t, adbSNP:147231661
complement(5385)-t, cdbSNP:34340053
complement(5424)-t, cdbSNP:114338020
complement(5433)-g, adbSNP:114845780
complement(5434)-t, cdbSNP:376135795
5455+a, gdbSNP:398124122
5462+g, tdbSNP:121434555
complement(5464)-g, adbSNP:143074017
complement(5515)-g, adbSNP:192930227
complement(5537)-g, adbSNP:201147199
complement(5546)-t, cdbSNP:77632596
complement(5550)-t, cdbSNP:140699766
complement(5561)-g, cdbSNP:150200531
complement(5598)-g, cdbSNP:114011175
complement(5600)-t, cdbSNP:140929211
complement(5626)-t, cdbSNP:145447965
complement(5654)-g, adbSNP:140513454
complement(5665)-t, cdbSNP:34528162
complement(5673)-t, cdbSNP:116565519
complement(5678)-t, cdbSNP:371441617
complement(5679)-g, adbSNP:202086524
complement(5688)-t, gdbSNP:114357878
5703+c, tdbSNP:398124123
complement(5742)-t, cdbSNP:377249790
complement(5755)-g, adbSNP:114131542
complement(5821)-dbSNP:
complement(5821)-c, adbSNP:199809359
complement(5827)-t, cdbSNP:78904746
complement(5832)-g, cdbSNP:201313985
complement(5840)-g, adbSNP:148488423
complement(5859)-g, adbSNP:114259747
complement(5874)-g, adbSNP:144592806
complement(5894)-t, cdbSNP:114804083
5895+a, cdbSNP:113153193
complement(5904)-g, adbSNP:146355600
complement(5915)-c, adbSNP:116308832
complement(5930)-g, adbSNP:368943871
complement(5937)-g, adbSNP:200285455
complement(5942)-t, cdbSNP:368379003
complement(5963)-g, adbSNP:143389941
complement(5964)-t, cdbSNP:149151423
5965+c, tdbSNP:112540218
complement(5966)-g, adbSNP:376002858
complement(5973)-t, gdbSNP:147896953
complement(5975)-g, adbSNP:370806359
complement(5997)-g, adbSNP:151234107
complement(6001)-g, adbSNP:148613877
complement(6003)-g, adbSNP:200999503
6019+a, gdbSNP:113251155
complement(6028)-g, adbSNP:201938007
complement(6029)-t, cdbSNP:374825188
6035+c, tdbSNP:398124124
complement(6038)-t, cdbSNP:139230842
complement(6079)-t, cdbSNP:113817270
6105+c, tdbSNP:113542401
complement(6108)-t, cdbSNP:373432063
complement(6110)-g, adbSNP:150694150
complement(6111)-t, cdbSNP:113283088
6118+c, gdbSNP:113332380
complement(6143)-dbSNP:
complement(6143)-t, gdbSNP:138314062
complement(6164)-g, adbSNP:371215375
complement(6181)-c, adbSNP:200110562
complement(6194)-t, cdbSNP:368635334
complement(6208)-dbSNP:
complement(6208)-g, adbSNP:369839261
complement(6209)-t, cdbSNP:375287084
complement(6220)-g, adbSNP:373458512
complement(6238)-t, cdbSNP:200478135
complement(6243)-g, adbSNP:141524902
complement(6253)-g, adbSNP:146546544
complement(6260)-c, adbSNP:375613015
complement(6282)-t, cdbSNP:372028656
complement(6286)-t, cdbSNP:201539582
complement(6306)-, cdbSNP:34589038
complement(6308)-c, adbSNP:369341191
complement(6325)-c, adbSNP:376548186
complement(6330)-g, adbSNP:148877230
complement(6336)-t, gdbSNP:149749803
complement(6338)-g, adbSNP:200239695
complement(6339)-t, cdbSNP:367696163
complement(6353)-dbSNP:
complement(6353)-t, cdbSNP:115320113
6355+a, gdbSNP:113418871
complement(6360)-g, adbSNP:375668409
complement(6383)-t, gdbSNP:374349826
complement(6390)-t, cdbSNP:35556524
complement(6413)-t, cdbSNP:142090771
complement(6423)-g, adbSNP:115401779
complement(6436)-t, gdbSNP:370397767
6441+c, gdbSNP:398124125
complement(6465)-dbSNP:
complement(6465)-g, adbSNP:115130936
complement(6467)-t, cdbSNP:376715966
6478+a, gdbSNP:397515332
complement(6503)-dbSNP:
complement(6503)-t, cdbSNP:185047948
6509+c, tdbSNP:113331139
complement(6510)-t, cdbSNP:368711215
complement(6522)-g, adbSNP:34390834
6548+c, tdbSNP:113896755
complement(6574)-dbSNP:
complement(6574)-g, adbSNP:148252611
complement(6575)-g, cdbSNP:79375816
complement(6597)-dbSNP:
complement(6597)-g, adbSNP:377074792
complement(6637)-c, adbSNP:374476448
complement(6652)-dbSNP:
complement(6652)-c, adbSNP:113283521
6654+a, gdbSNP:2646254
complement(6703)-dbSNP:
complement(6703)-t, cdbSNP:372697731
complement(6707)-t, gdbSNP:369169235
complement(6717)-t, cdbSNP:375743769
complement(6746)-t, cdbSNP:145561490
complement(6755)-g, adbSNP:372281922
complement(6762)-dbSNP:
complement(6762)-g, adbSNP:149697986
complement(6803)-t, gdbSNP:200842141
complement(6823)-dbSNP:
complement(6823)-t, cdbSNP:374335627
complement(6840)-g, adbSNP:199869924
complement(6856)-g, adbSNP:370056446
complement(6903)-dbSNP:
complement(6903)-g, adbSNP:201814201
6907+g, tdbSNP:398124129
complement(6938)-dbSNP:
complement(6938)-g, adbSNP:36117715
complement(6939)-t, cdbSNP:147537071
complement(6958)-t, cdbSNP:138588234
complement(6962)-g, adbSNP:376621780
complement(6988)-dbSNP:
complement(6988)-g, adbSNP:369948687
complement(6991)-t, cdbSNP:183479932
6992+c, gdbSNP:113782024
complement(7034)-g, adbSNP:140728855
complement(7036)-g, adbSNP:116690555
complement(7039)-dbSNP:
complement(7039)-t, cdbSNP:149386939
complement(7044)-g, adbSNP:375134458
complement(7045)-t, cdbSNP:139768780
complement(7054)-t, cdbSNP:372154635
complement(7083)-g, adbSNP:116541926
complement(7125)-dbSNP:
complement(7125)-t, cdbSNP:149069735
complement(7137)-g, adbSNP:374952003
complement(7140)-g, cdbSNP:3790993
complement(7153)-g, adbSNP:116608946
7154+g, tdbSNP:398124131
complement(7184)-dbSNP:
complement(7184)-t, cdbSNP:145572916
7187+c, tdbSNP:111927395
complement(7201)-g, adbSNP:370862741
7230+dbSNP:
7230+c, tdbSNP:2646265
7257+dbSNP:
7257+c, tdbSNP:113961575
complement(7266)-t, cdbSNP:35993209
complement(7267)-g, adbSNP:371637449
complement(7292)-t, gdbSNP:202092407
complement(7310)-t, cdbSNP:369317566
complement(7314)-c, adbSNP:200096684
complement(7316)-dbSNP:
complement(7316)-t, cdbSNP:367725413
complement(7322)-g, adbSNP:377168716
complement(7371)-t, gdbSNP:35902696
complement(7398)-dbSNP:
complement(7398)-g, adbSNP:375729592
complement(7399)-t, cdbSNP:142002241
complement(7409)-t, cdbSNP:373345733
complement(7443)-dbSNP:
complement(7443)-t, cdbSNP:376714139
complement(7458)-dbSNP:
complement(7458)-g, adbSNP:114248590
complement(7477)-dbSNP:
complement(7477)-t, cdbSNP:375640580
complement(7496)-g, adbSNP:374451456
complement(7509)-g, cdbSNP:377084627
complement(7543)-g, adbSNP:150165484
complement(7614)-g, adbSNP:10084221
complement(7644)-t, cdbSNP:114199044
complement(7645)-t, cdbSNP:147792340
complement(7660)-g, adbSNP:371066956
7685+c, tdbSNP:111803773
complement(7686)-t, cdbSNP:377572272
complement(7708)-t, adbSNP:373432044
complement(7726)-t, cdbSNP:201467603
complement(7732)-t, cdbSNP:139260335
7750+a, gdbSNP:113360980
complement(7761)-t, cdbSNP:150815991
complement(7794)-t, cdbSNP:34181055
complement(7797)-g, adbSNP:2646258
complement(7823)-t, gdbSNP:199609978
complement(7827)-g, c, adbSNP:112463519
complement(7843)-t, adbSNP:144152285
complement(7871)-g, adbSNP:146938113
complement(7875)-t, cdbSNP:115591088
complement(7876)-g, cdbSNP:75618738
complement(7881)-t, cdbSNP:2291795
complement(7896)-c, adbSNP:145868338
complement(7904)-g, adbSNP:373624266
complement(7930)-g, adbSNP:151079701
complement(7931)-t, cdbSNP:115863049
complement(7944)-g, adbSNP:369335838
complement(7955)-dbSNP:
complement(7955)-t, adbSNP:146872525
complement(7970)-g, adbSNP:143631346
complement(7980)-t, c, adbSNP:200456255
complement(7987)-g, adbSNP:201479636
complement(8033)-g, adbSNP:140021275
complement(8040)-g, adbSNP:145581705
complement(8053)-dbSNP:
complement(8053)-t, cdbSNP:372278071
complement(8064)-g, adbSNP:144249704
complement(8093)-t, cdbSNP:150554876
complement(8117)-g, adbSNP:114806654
complement(8124..8125)-, adbSNP:35288868
complement(8127)-g, adbSNP:34558385
complement(8128)-t, c, adbSNP:145884404
complement(8134)-t, cdbSNP:138285547
8158+g, tdbSNP:112104700
complement(8163)-g, adbSNP:145136426
complement(8188)-g, adbSNP:377679398
8213+c, tdbSNP:111595697
complement(8214)-t, cdbSNP:4433949
complement(8238)-t, cdbSNP:369537287
complement(8268)-g, adbSNP:375222168
complement(8280)-t, gdbSNP:80193928
complement(8282)-c, adbSNP:75349214
8293+a, gdbSNP:398124135
complement(8294)-g, adbSNP:142851023
complement(8295)-t, cdbSNP:79313758
complement(8302)-t, cdbSNP:148017477
complement(8307)-g, adbSNP:149403952
complement(8360)-t, cdbSNP:371571488
complement(8382)-t, cdbSNP:115757876
complement(8430)-t, cdbSNP:35763271
complement(8443)-t, cdbSNP:368129741
complement(8453)-g, adbSNP:373108028
complement(8474)-t, gdbSNP:138466455
complement(8478)-t, gdbSNP:140441798
complement(8486)-t, cdbSNP:115116398
8494+a, cdbSNP:111764507
complement(8497)-t, adbSNP:141344389
complement(8498)-g, adbSNP:144541891
complement(8516)-g, adbSNP:373680762
8521+a, gdbSNP:111395856
complement(8528)-g, adbSNP:115595706
8529+a, gdbSNP:113754336
complement(8542)-g, cdbSNP:144130137
complement(8592)-g, adbSNP:149890179
complement(8625)-g, adbSNP:114643468
complement(8631)-t, cdbSNP:35911211
8643+c, tdbSNP:113423040
complement(8670)-g, adbSNP:201460305
complement(8680)-t, cdbSNP:367744524
complement(8699)-t, g, cdbSNP:35848091
complement(8700)-g, adbSNP:375442243
complement(8716)-g, adbSNP:371361651
complement(8722)-t, cdbSNP:146131332
complement(8736)-t, c, adbSNP:61729844
complement(8742)-g, adbSNP:138683303
complement(8743)-t, cdbSNP:115171119
complement(8760)-dbSNP:
complement(8760)-g, adbSNP:144451681
complement(8776)-g, cdbSNP:36104025
complement(8792)-t, cdbSNP:372900447
complement(8795)-t, adbSNP:114306849
complement(8816)-t, gdbSNP:369032069
8857+dbSNP:
8857+a, gdbSNP:111859552
complement(8868)-g, adbSNP:375994186
complement(8869)-t, cdbSNP:371745862
complement(8911)-g, cdbSNP:139883752
complement(8912)-g, adbSNP:367635298
complement(8913)-t, cdbSNP:143006225
complement(8921)-g, adbSNP:150907698
8930+c, tdbSNP:112178393
complement(8958..8959)-, gdbSNP:376864952
complement(8958)-t, gdbSNP:113026406
complement(8980)-t, cdbSNP:115839474
complement(9009)-g, adbSNP:114684687
complement(9010)-t, cdbSNP:201917052
9020+c, tdbSNP:112928650
complement(9028)-t, cdbSNP:377528704
9030+a, gdbSNP:112382351
complement(9065)-g, adbSNP:6728818
complement(9083)-g, adbSNP:373550111
complement(9084)-t, cdbSNP:139811166
complement(9089)-g, adbSNP:36020669
complement(9090)-t, cdbSNP:200111289
complement(9093)-t, cdbSNP:193262655
complement(9095)-t, cdbSNP:146454821
complement(9104)-g, adbSNP:200626456
complement(9105)-t, g, cdbSNP:11683438
complement(9107)-g, adbSNP:11903206
complement(9131)-g, adbSNP:376021820
complement(9136)-g, cdbSNP:373948506
complement(9150)-g, adbSNP:199936838
complement(9153)-, agcdbSNP:398102314
complement(9162..9164)-, gcadbSNP:35879189
complement(9177)-t, cdbSNP:147324162
complement(9180)-t, gdbSNP:114008087
complement(9192)-g, adbSNP:201605617
complement(9247)-t, cdbSNP:11690358
9255+dbSNP:
9255+a, gdbSNP:113721676
complement(9262)-g, adbSNP:148318789
complement(9263)-t, cdbSNP:201888442
complement(9285)-t, cdbSNP:376142052
complement(9297)-g, adbSNP:199519571
9302+a, gdbSNP:2270668
9319+c, gdbSNP:2270669
complement(9330)-g, adbSNP:144834964
complement(9344)-t, cdbSNP:371006546
complement(9346)-g, cdbSNP:144054353
9354+c, tdbSNP:111234422
complement(9360)-g, cdbSNP:201060916
complement(9375)-g, cdbSNP:148770439
complement(9381)-c, adbSNP:147327623
complement(9401)-g, adbSNP:116655315
complement(9402)-t, cdbSNP:376780810
complement(9408)-t, cdbSNP:61729843
complement(9414)-g, adbSNP:10201909
complement(9415)-t, cdbSNP:374628435
complement(9432)-g, adbSNP:183247300
complement(9433)-t, cdbSNP:114596320
complement(9465)-g, cdbSNP:376939353
9491+c, tdbSNP:1131296
complement(9494)-t, cdbSNP:368568929
9498+c, tdbSNP:2270671
complement(9500)-t, cdbSNP:372636697
complement(9502)-t, cdbSNP:199680718
complement(9530)-dbSNP:
complement(9530)-g, cdbSNP:182976977
complement(9534)-g, adbSNP:77368269
complement(9549)-c, adbSNP:376361222
complement(9577)-t, cdbSNP:115303741
9601+c, tdbSNP:112455407
complement(9623)-dbSNP:
complement(9623)-t, cdbSNP:201169014
9624+a, gdbSNP:113422196
complement(9629)-g, adbSNP:138109666
complement(9636)-g, adbSNP:148821986
complement(9643)-t, gdbSNP:141050617
complement(9651)-t, cdbSNP:114196732
complement(9671)-t, cdbSNP:145528484
complement(9679)-g, adbSNP:147533489
9696+c, tdbSNP:112290343
complement(9706)-g, adbSNP:376564469
complement(9729)-g, adbSNP:144291325
complement(9730)-t, cdbSNP:138694883
complement(9736)-t, cdbSNP:371468515
9765+a, gdbSNP:113992704
complement(9774)-t, adbSNP:367728719
complement(9783)-dbSNP:
complement(9783)-g, adbSNP:150376179
complement(9809)-g, adbSNP:148183839
complement(9826)-g, cdbSNP:4663722
complement(9841)-g, adbSNP:375729697
complement(9870)-g, adbSNP:188002584
complement(9871)-t, cdbSNP:374558518
complement(9905)-g, adbSNP:370590562
complement(9945)-t, cdbSNP:367628527
complement(10022)-t, gdbSNP:138322330
complement(10169..10170)-, tdbSNP:34592847
10265+c, tdbSNP:113274130
complement(10333)-t, cdbSNP:386513947
10333+c, tdbSNP:1050765
10425+a, tdbSNP:7436
complement(10482)-c, adbSNP:184900191
complement(10484)-, cdbSNP:200357374
10484+g, tdbSNP:1050785
complement(10485..10486)-, adbSNP:139839139
Gene SymbolCOL6A3
Gene SynonymCOL6A3
Chromosome2
Locus Map2q37
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_057166 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 4, mRNA. On-demand $3749.00 35
NM_057167 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 5, mRNA. On-demand $4749.00 40
NM_057164 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 2, mRNA. On-demand $1699.00 25
NM_057165 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 3, mRNA. On-demand $1699.00 25
NM_004369 Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant 1, mRNA. In-stock $2448.00 $2399.00 24
XM_006712253 PREDICTED: Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant X3, mRNA. On-demand $4749.00 40
XM_005246065 PREDICTED: Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant X1, mRNA. On-demand $4749.00 40
XM_005246066 PREDICTED: Homo sapiens collagen, type VI, alpha 3 (COL6A3), transcript variant X2, mRNA. On-demand $4749.00 40
Title Genome-wide DNA methylation analysis reveals a potential mechanism for the pathogenesis and development of uterine leiomyomas .
Author Maekawa R, Sato S, Yamagata Y, Asada H, Tamura I, Lee L, Okada M, Tamura H, Takaki E, Nakai A and Sugino N.
Journal PLoS ONE 8 (6), E66632 (2013)
Title A genome-wide association study of aging .
Author Walter S, Atzmon G, Demerath EW, Garcia ME, Kaplan RC, Kumari M, Lunetta KL, Milaneschi Y, Tanaka T, Tranah GJ, Volker U, Yu L, Arnold A, Benjamin EJ, Biffar R, Buchman AS, Boerwinkle E, Couper D, De Jager PL, Evans DA, Harris TB, Hoffmann W, Hofman A, Karasik D, Kiel DP, Kocher T, Kuningas M, Launer LJ, Lohman KK, Lutsey PL, Mackenbach J, Marciante K, Psaty BM, Reiman EM, Rotter JI, Seshadri S, Shardell MD, Smith AV, van Duijn C, Walston J, Zillikens MC, Bandinelli S, Baumeister SE, Bennett DA, Ferrucci L, Gudnason V, Kivimaki M, Liu Y, Murabito JM, Newman AB, Tiemeier H and Franceschini N.
Journal Neurobiol. Aging 32 (11), 2109 (2011)
Title The 1.6 A structure of Kunitz-type domain from the alpha 3 chain of human type VI collagen .
Author Arnoux B, Merigeau K, Saludjian P, Norris F, Norris K, Bjorn S, Olsen O, Petersen L and Ducruix A.
Journal J. Mol. Biol. 246 (5), 609-617 (1995)
Title Collagen Type VI-Related Disorders .
Author Lampe,A.K., Flanigan,K.M., Bushby,K.M. and Hicks,D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Congenital Muscular Dystrophy Overview .
Author Sparks,S., Quijano-Roy,S., Harper,A., Rutkowski,A., Gordon,E., Hoffman,E.P. and Pegoraro,E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title The human type VI collagen gene. mRNA and protein variants of the alpha 3 chain generated by alternative splicing of an additional 5-end exon .
Author Zanussi S, Doliana R, Segat D, Bonaldo P and Colombatti A.
Journal J. Biol. Chem. 267 (33), 24082-24089 (1992)
Title Mosaic structure of globular domains in the human type VI collagen alpha 3 chain: similarity to von Willebrand factor, fibronectin, actin, salivary proteins and aprotinin type protease inhibitors .
Author Chu ML, Zhang RZ, Pan TC, Stokes D, Conway D, Kuo HJ, Glanville R, Mayer U, Mann K and Deutzmann R.
Journal EMBO J. 9 (2), 385-393 (1990)
Title Amino acid sequence of the triple-helical domain of human collagen type VI .
Author Chu ML, Conway D, Pan TC, Baldwin C, Mann K, Deutzmann R and Timpl R.
Journal J. Biol. Chem. 263 (35), 18601-18606 (1988)
Title Cloning and chromosomal localization of human genes encoding the three chains of type VI collagen .
Author Weil D, Mattei MG, Passage E, N'Guyen VC, Pribula-Conway D, Mann K, Deutzmann R, Timpl R and Chu ML.
Journal Am. J. Hum. Genet. 42 (3), 435-445 (1988)
Title Characterization of three constituent chains of collagen type VI by peptide sequences and cDNA clones .
Author Chu ML, Mann K, Deutzmann R, Pribula-Conway D, Hsu-Chen CC, Bernard
Journal Eur. J. Biochem. 168 (2), 309-317 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.