• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tRNA aspartic acid methyltransferase 1 (TRDMT1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu08189 Homo sapiens tRNA aspartic acid methyltransferase 1 (TRDMT1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu08189C Homo sapiens tRNA aspartic acid methyltransferase 1 (TRDMT1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004412.5, 297591820
Length 1176 bp
Structure linear
Update Date 27-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens tRNA aspartic acid methyltransferase 1 (TRDMT1), mRNA.
Product tRNA (cytosine(38)-C(5))-methyltransferase
Comment

Summary: This gene encodes a protein responsible for the methylation of aspartic acid transfer RNA, specifically at the cytosine-38 residue in the anticodon loop. This enzyme also possesses residual DNA-(cytosine-C5) methyltransferase activity. While similar in sequence and structure to DNA cytosine methyltransferases, this gene is distinct and highly conserved in its function among taxa. [provided by RefSeq, Jun 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004403.1
CDS 438..1613
Misc Feature(1)426..428
Misc Feature(2)447..1610
Misc Feature(3)447..1610
Misc Feature(4)order(465..482,534..545,600..611,663..665,669..671)
Misc Feature(5)order(663..665,672..677,684..695,702..704,720..722,
Misc Feature(6)order(663..665,672..674,684..686,792..794,798..800,
Exon (1)1..501
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (2)502..611
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (3)612..688
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (4)689..760
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (5)761..826
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (6)827..896
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (7)897..980
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (8)981..1324
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (9)1325..1382
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (10)1383..1512
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Exon (11)1513..7670
Gene:TRDMT1
Gene Synonym:DMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Translation MEPLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGI TLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLEN VKGFEVSSTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPG QVLMEFPKIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHR KNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYALLLDIVQPTCRRSVCFTKGYGSY IEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRYFTPKEIANLLGFPPEFGF PEKITVKQRYRLLGNSLNVHVVAKLIKILYE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-g, adbSNP:151030273
complement(23)-t, cdbSNP:17381591
complement(59)-g, adbSNP:143675703
complement(86)-t, adbSNP:140607171
complement(117)-t, gdbSNP:191554587
complement(132)-t, cdbSNP:112008233
complement(163)-g, adbSNP:370971943
complement(172)-g, cdbSNP:186258196
275+c, tdbSNP:2281647
complement(307)-g, cdbSNP:117798350
complement(358)-t, cdbSNP:372417260
complement(385)-t, cdbSNP:182058526
complement(433)-g, cdbSNP:11254458
complement(434)-t, cdbSNP:374212992
complement(489)-g, cdbSNP:368191514
complement(513)-dbSNP:
complement(513)-g, cdbSNP:373467609
complement(527)-t, cdbSNP:116026632
complement(563)-t, cdbSNP:376716923
complement(593)-t, cdbSNP:150512384
complement(601)-t, cdbSNP:142485098
605+a, gdbSNP:2273734
complement(607)-g, adbSNP:201980772
complement(615)-dbSNP:
complement(615)-g, adbSNP:35597944
complement(647)-g, adbSNP:7096233
complement(648)-t, cdbSNP:371526424
complement(652)-g, adbSNP:183603154
complement(697)-dbSNP:
complement(697)-t, cdbSNP:372387101
complement(698)-t, cdbSNP:199876591
complement(703)-t, cdbSNP:138942626
complement(710)-t, cdbSNP:146113029
complement(712)-g, adbSNP:368646159
complement(724)-g, adbSNP:143074583
complement(725)-g, cdbSNP:138454921
complement(738)-g, adbSNP:11254413
complement(810)-dbSNP:
complement(810)-t, cdbSNP:371682545
complement(840)-dbSNP:
complement(840)-g, adbSNP:374843389
complement(846)-t, cdbSNP:370788954
875+a, gdbSNP:1132158
complement(891)-t, cdbSNP:376428407
complement(892)-g, adbSNP:375260069
complement(897)-dbSNP:
complement(897)-t, gdbSNP:370715356
complement(921)-g, adbSNP:377038005
complement(922)-t, cdbSNP:373841689
complement(949)-g, adbSNP:141411248
complement(973)-g, cdbSNP:200247836
complement(984)-dbSNP:
complement(984)-g, adbSNP:115493360
complement(986)-c, adbSNP:11254408
complement(991)-t, cdbSNP:201936180
complement(995)-g, adbSNP:200499175
complement(1030)-t, gdbSNP:200204830
complement(1046)-g, adbSNP:369412690
complement(1100)-t, cdbSNP:376822314
complement(1115)-c, adbSNP:142403002
complement(1214)-g, adbSNP:368238932
complement(1219)-g, adbSNP:113738252
complement(1236)-g, cdbSNP:375924016
complement(1257)-t, gdbSNP:147828589
complement(1259)-c, adbSNP:145913291
complement(1260)-g, adbSNP:142276706
complement(1281)-t, cdbSNP:145087683
complement(1304)-t, cdbSNP:373441421
complement(1307)-g, adbSNP:201181750
complement(1328)-dbSNP:
complement(1328)-g, adbSNP:373596044
complement(1358)-t, cdbSNP:149889117
complement(1397)-dbSNP:
complement(1397)-t, gdbSNP:367631460
complement(1449)-g, adbSNP:139020167
complement(1458)-t, gdbSNP:151176125
complement(1459)-t, cdbSNP:143289233
complement(1466)-g, adbSNP:139846266
complement(1471)-g, adbSNP:146125562
complement(1485)-t, cdbSNP:376209431
complement(1512)-t, cdbSNP:201588841
complement(1523)-dbSNP:
complement(1523)-g, cdbSNP:144121793
complement(1527)-t, cdbSNP:370811105
complement(1543)-c, adbSNP:200539562
complement(1562)-g, adbSNP:199788631
complement(1584)-t, cdbSNP:142955883
complement(1601)-t, gdbSNP:60311815
complement(1605)-g, adbSNP:376223529
complement(1660)-t, gdbSNP:372734524
complement(1809)-t, adbSNP:377171607
1887+a, gdbSNP:3736821
complement(1917)-t, cdbSNP:186477234
complement(1961)-t, adbSNP:183621136
complement(1981..1984)-, ttaadbSNP:111372071
complement(2063)-t, adbSNP:12761062
complement(2091)-t, cdbSNP:11254405
complement(2167)-t, gdbSNP:191858696
complement(2175)-c, adbSNP:12785102
complement(2194)-t, cdbSNP:188201970
complement(2251)-t, cdbSNP:17139972
complement(2360)-g, adbSNP:139360309
complement(2368)-t, cdbSNP:146276568
complement(2445)-g, cdbSNP:373692539
complement(2471)-t, gdbSNP:10904889
complement(2515)-g, adbSNP:116816958
complement(2573)-t, cdbSNP:76242851
complement(2695)-t, adbSNP:141924717
complement(2706)-g, cdbSNP:372578166
complement(2728)-t, cdbSNP:183556682
complement(2751)-t, cdbSNP:10904888
complement(2789)-t, cdbSNP:116232424
complement(2828)-t, cdbSNP:191725738
complement(2842)-t, gdbSNP:188844079
complement(2856)-g, cdbSNP:183213121
complement(2861)-t, cdbSNP:191020957
complement(2880)-g, adbSNP:4748359
complement(2908)-g, cdbSNP:11254403
complement(2908)-g, cdbSNP:386423950
complement(2914)-c, adbSNP:139704951
complement(2984)-t, cdbSNP:45452997
complement(3001)-t, gdbSNP:185470621
complement(3053)-t, gdbSNP:10159806
complement(3062)-t, cdbSNP:11254402
complement(3130)-g, adbSNP:376089556
complement(3132)-t, cdbSNP:373497842
complement(3154)-t, cdbSNP:141886485
complement(3181)-t, adbSNP:369525369
complement(3235)-t, adbSNP:148125636
complement(3440)-g, adbSNP:180802876
complement(3454)-g, adbSNP:191284365
complement(3534)-g, adbSNP:186388661
complement(3634)-g, adbSNP:12258508
complement(3646)-t, adbSNP:181767679
complement(3657)-t, cdbSNP:190073551
complement(3724)-t, cdbSNP:143219518
complement(3739)-g, adbSNP:45525834
complement(3751..3752)-, tdbSNP:397897448
complement(3755..3756)-, tdbSNP:45599041
complement(3783)-g, cdbSNP:61841778
complement(3834)-t, adbSNP:11254401
complement(3843)-t, cdbSNP:77140981
complement(3868)-t, cdbSNP:7900327
complement(3884)-c, adbSNP:185574159
complement(3914)-t, cdbSNP:182037060
complement(3959)-t, gdbSNP:146910247
complement(4011)-t, cdbSNP:10904887
complement(4014)-g, adbSNP:189296897
complement(4015)-t, cdbSNP:7900163
complement(4023)-t, cdbSNP:11254400
complement(4074)-g, cdbSNP:7075056
complement(4090)-t, gdbSNP:78524842
complement(4138)-t, cdbSNP:7075029
complement(4178)-t, cdbSNP:7074891
complement(4199)-c, adbSNP:61841764
complement(4202)-t, cdbSNP:45507399
complement(4239)-t, gdbSNP:149225634
4267+c, tdbSNP:2176286
complement(4267)-g, adbSNP:386559787
complement(4406)-t, cdbSNP:78387850
complement(4468)-c, adbSNP:12770606
complement(4580)-t, adbSNP:7070966
4611+a, cdbSNP:145451810
complement(4629)-g, adbSNP:7071287
complement(4667)-t, gdbSNP:150098992
complement(4699)-g, cdbSNP:7070931
complement(4706)-t, gdbSNP:183753003
complement(4856)-t, cdbSNP:370148606
complement(4915)-t, cdbSNP:12241572
complement(4930)-g, adbSNP:75687718
complement(4940)-t, cdbSNP:140775567
complement(4942)-t, gdbSNP:112309590
complement(4948)-t, adbSNP:116757696
complement(4991)-g, cdbSNP:11254399
complement(5018)-g, cdbSNP:34434809
complement(5054)-g, adbSNP:12354706
complement(5058)-g, adbSNP:150958422
complement(5077)-t, adbSNP:144076807
complement(5131)-g, cdbSNP:372882059
complement(5215)-c, adbSNP:139323864
complement(5276)-t, cdbSNP:111759016
complement(5319)-t, gdbSNP:146748160
complement(5347)-g, adbSNP:143463770
complement(5367..5368)-, adbSNP:398114113
complement(5371..5372)-, g, tttttg, tttttgttttgdbSNP:71377021
complement(5371)-c, adbSNP:117325820
complement(5375..5376)-, a, aaaacaaaaca, caaaadbSNP:138056262
complement(5386..5387)-, acaaadbSNP:145433528
complement(5387)-t, adbSNP:12764129
complement(5394)-g, adbSNP:12764123
complement(5405..5406)-, aaaacdbSNP:111992616
complement(5577)-t, cdbSNP:148700807
complement(5632)-g, adbSNP:73604239
complement(5652)-c, adbSNP:144230913
complement(5679)-g, adbSNP:149563031
complement(5714)-t, gdbSNP:369056224
complement(5804)-t, cdbSNP:139283795
complement(5893)-t, cdbSNP:116231647
complement(5945)-t, cdbSNP:191195155
complement(5980)-t, cdbSNP:77450030
complement(6000)-t, cdbSNP:188069465
complement(6027)-t, cdbSNP:11254398
complement(6072)-g, adbSNP:184751225
complement(6101)-c, adbSNP:116448365
complement(6205)-t, cdbSNP:56394211
6240+c, tdbSNP:147487270
complement(6251)-c, adbSNP:143178327
complement(6324)-g, adbSNP:192907129
complement(6339)-g, adbSNP:376696678
complement(6342)-c, adbSNP:188841581
complement(6506)-t, cdbSNP:111824003
complement(6733..6737)-, ttgatdbSNP:45554433
complement(6735..6739)-, atttgdbSNP:112711850
complement(6735)-t, cdbSNP:200578175
complement(6821)-g, cdbSNP:372392091
complement(6842)-g, adbSNP:10904886
complement(6879)-t, gdbSNP:73604238
complement(6905)-t, adbSNP:139220193
complement(6933)-t, adbSNP:368336669
complement(7082)-g, adbSNP:183002336
complement(7083)-t, cdbSNP:12248293
complement(7131)-t, gdbSNP:146841898
complement(7168)-g, adbSNP:11254397
complement(7187..7188)-, cdbSNP:201060893
complement(7250)-t, cdbSNP:11254396
complement(7267)-t, cdbSNP:371944583
complement(7277)-g, adbSNP:367859281
complement(7278)-t, cdbSNP:61841763
complement(7339)-g, adbSNP:12248256
complement(7494)-t, cdbSNP:192624034
complement(7538)-t, gdbSNP:202160458
Gene SymbolTRDMT1
Gene SynonymDMNT2; DNMT2; MHSAIIP; PUMET; RNMT1
Chromosome10
Locus Map10p15.1
Title Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease .
Author van Meurs JB, Pare G, Schwartz SM, Hazra A, Tanaka T, Vermeulen SH, Cotlarciuc I, Yuan X, Malarstig A, Bandinelli S, Bis JC, Blom H, Brown MJ, Chen C, Chen YD, Clarke RJ, Dehghan A, Erdmann J, Ferrucci L, Hamsten A, Hofman A, Hunter DJ, Goel A, Johnson AD, Kathiresan S, Kampman E, Kiel DP, Kiemeney LA, Chambers JC, Kraft P, Lindemans J, McKnight B, Nelson CP, O'Donnell CJ, Psaty BM, Ridker PM, Rivadeneira F, Rose LM, Seedorf U, Siscovick DS, Schunkert H, Selhub J, Ueland PM, Vollenweider P, Waeber G, Waterworth DM, Watkins H, Witteman JC, den Heijer M, Jacques P, Uitterlinden AG, Kooner JS, Rader DJ, Reilly MP, Mooser V, Chasman DI, Samani NJ and Ahmadi KR.
Journal Am. J. Clin. Nutr. 98 (3), 668-676 (2013)
Title Mapping the tRNA binding site on the surface of human DNMT2 methyltransferase .
Author Jurkowski TP, Shanmugam R, Helm M and Jeltsch A.
Journal Biochemistry 51 (22), 4438-4444 (2012)
Title The DNA methyltranferase Dnmt2 participates in RNA processing during cellular stress .
Author Thiagarajan D, Dev RR and Khosla S.
Journal Epigenetics 6 (1), 103-113 (2011)
Title Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author Flachsbart F, Franke A, Kleindorp R, Caliebe A, Blanche H, Schreiber S and Nebel A.
Journal Mutat. Res. 694 (1-2), 13-19 (2010)
Title Methylation of tRNAAsp by the DNA methyltransferase homolog Dnmt2 .
Author Goll MG, Kirpekar F, Maggert KA, Yoder JA, Hsieh CL, Zhang X, Golic KG, Jacobsen SE and Bestor TH.
Journal Science 311 (5759), 395-398 (2006)
Title Structure of human DNMT2, an enigmatic DNA methyltransferase homolog that displays denaturant-resistant binding to DNA .
Author Dong A, Yoder JA, Zhang X, Zhou L, Bestor TH and Cheng X.
Journal Nucleic Acids Res. 29 (2), 439-448 (2001)
Title Dnmt2 is not required for de novo and maintenance methylation of viral DNA in embryonic stem cells .
Author Okano M, Xie S and Li E.
Journal Nucleic Acids Res. 26 (11), 2536-2540 (1998)
Title Cloning and analysis of a novel human putative DNA methyltransferase .
Author Van den Wyngaert I, Sprengel J, Kass SU and Luyten WH.
Journal FEBS Lett. 426 (2), 283-289 (1998)
Title A candidate mammalian DNA methyltransferase related to pmt1p of fission yeast .
Author Yoder JA and Bestor TH.
Journal Hum. Mol. Genet. 7 (2), 279-284 (1998)
Title Assignment of candidate DNA methyltransferase gene (DNMT2) to human chromosome band 10p15.1 by in situ hybridization .
Author Vilain A, Apiou F, Dutrillaux B and Malfoy B.
Journal Cytogenet. Cell Genet. 82 (1-2), 120 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.