• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ephrin-B1 (EFNB1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004429 Homo sapiens ephrin-B1 (EFNB1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_004429.4, 183603932
Length 3344 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ephrin-B1 (EFNB1), mRNA.
Product ephrin-B1 precursor
Comment

Summary: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008].

RefSeq NP_004420.1
CDS 781..1821
Misc Feature(1)250..252
Misc Feature(2)871..1275
Misc Feature(3)order(955..957,1066..1074,1087..1089,1096..1101,
Misc Feature(4)1492..1554
Misc Feature(5)1639..1641
Misc Feature(6)1750..1752
Misc Feature(7)1765..1767
Misc Feature(8)1807..1809
Misc Feature(9)1810..1818
Exon (1)1..908
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
Exon (2)909..1186
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
Exon (3)1187..1279
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
Exon (4)1280..1408
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
Exon (5)1409..3331
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
Translation MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
45..47+dbSNP:
45..47+, ggadbSNP:200409757
86+c, tdbSNP:189750013
273+c, gdbSNP:184030244
396+g, tdbSNP:187341605
552+a, gdbSNP:139698751
758..759+, adbSNP:35579950
889+g, tdbSNP:104894802
890+a, gdbSNP:104894803
913+dbSNP:
913+c, tdbSNP:145603720
941+c, tdbSNP:104894801
942+a, gdbSNP:1056028
972+c, tdbSNP:148907346
976+c, tdbSNP:104894804
1042+a, gdbSNP:143648191
1112+c, tdbSNP:104894796
1196+dbSNP:
1196+a, tdbSNP:148094474
1202+c, gdbSNP:142430452
1231+a, gdbSNP:28936069
1232+g, tdbSNP:28936070
1241+a, gdbSNP:146636295
1252+a, gdbSNP:28936071
1254+g, tdbSNP:28935170
1289+dbSNP:
1289+c, tdbSNP:147599832
1295+c, tdbSNP:7889678
1320+g, tdbSNP:143162125
1345+a, gdbSNP:150883256
1346+c, tdbSNP:16989105
1377+g, tdbSNP:200409169
1379+c, gdbSNP:149648624
1425+dbSNP:
1425+a, gdbSNP:144441935
1465+g, tdbSNP:139138728
1507+a, gdbSNP:201249059
1512+c, tdbSNP:7890214
1539+a, gdbSNP:35567709
1607+a, gdbSNP:139877825
1608+g, tdbSNP:183532593
1623+a, g, tdbSNP:143341175
1671+a, gdbSNP:35202024
1827+c, tdbSNP:2230423
1881+c, tdbSNP:187874806
1913+c, tdbSNP:192352004
1989+c, gdbSNP:183063780
2125+c, tdbSNP:3196658
2173+c, tdbSNP:41312134
2207..2208+, tdbSNP:201242983
2208+, tdbSNP:35418748
2328+a, gdbSNP:188235570
2390+a, gdbSNP:1804569
2429+g, tdbSNP:1804568
2525..2526+, cadbSNP:66565095
2526..2527+, acdbSNP:71947464
2528..2529+, acacdbSNP:71684885
2528+, acacacdbSNP:3838388
2551..2552+, cdbSNP:61387446
2551+a, cdbSNP:199636325
2551+, cdbSNP:200158453
2553..2554+, cdbSNP:58007755
2553+g, tdbSNP:16990748
2554..2555+, cdbSNP:57536611
2554+a, cdbSNP:59751961
2555..2556+, c, cacdbSNP:59133604
2555+g, tdbSNP:688969
2556..2557+, cdbSNP:71765677
2708+g, tdbSNP:1056069
2715+a, gdbSNP:1056070
2851+c, tdbSNP:199742261
3030+g, tdbSNP:192955667
3085+c, tdbSNP:184659322
3179+a, cdbSNP:15090
3303..3304+, adbSNP:72425061
Gene SymbolEFNB1
Gene SynonymCFND; CFNS; EFL3; Elk-L; EPLG2; LERK2
ChromosomeX
Locus MapXq12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004429 Homo sapiens ephrin-B1 (EFNB1), mRNA. In-stock $418.00 $369.00 10
Title Nm23-H1 regulates contact inhibition of locomotion, which is affected by ephrin-B1 .
Author Tanaka,M., Kuriyama,S. and Aiba,N.
Journal J. Cell. Sci. 125 (PT 18), 4343-4353 (2012)
Title ErbB2, EphrinB1, Src kinase and PTPN13 signaling complex regulates .
Author Vermeer,P.D., Bell,M., Lee,K., Vermeer,D.W., Wieking,B.G., Bilal,E., Bhanot,G., Drapkin,R.I., Ganesan,S., Klingelhutz,A.J., Hendriks,W.J. and Lee,J.H.
Journal PLoS ONE 7 (1), E30447 (2012)
Title Duplication of the EFNB1 gene in familial hypertelorism: imbalance in ephrin-B1 expression and abnormal phenotypes in humans and mice .
Author Babbs,C., Stewart,H.S., Williams,L.J., Connell,L., Goriely,A., Twigg,S.R., Smith,K., Lester,T. and Wilkie,A.O.
Journal Hum. Mutat. 32 (8), 930-938 (2011)
Title A novel EFNB1 mutation (c.712delG) in a family with craniofrontonasal syndrome and diaphragmatic hernia .
Author Hogue,J., Shankar,S., Perry,H., Patel,R., Vargervik,K. and Slavotinek,A.
Journal Am. J. Med. Genet. A 152A (10), 2574-2577 (2010)
Title Prevalence and complications of single-gene and chromosomal disorders in craniosynostosis .
Author Wilkie,A.O., Byren,J.C., Hurst,J.A., Jayamohan,J., Johnson,D., Knight,S.J., Lester,T., Richards,P.G., Twigg,S.R. and Wall,S.A.
Journal Pediatrics 126 (2), E391-E400 (2010)
Title Cell-cell adhesion mediated by binding of membrane-anchored ligand LERK-2 to the EPH-related receptor human embryonal kinase 2 promotes tyrosine kinase activity .
Author Bohme,B., VandenBos,T., Cerretti,D.P., Park,L.S., Holtrich,U., Rubsamen-Waigmann,H. and Strebhardt,K.
Journal J. Biol. Chem. 271 (40), 24747-24752 (1996)
Title The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3 .
Author Cerretti,D.P., Lyman,S.D., Kozlosky,C.J., Copeland,N.G., Gilbert,D.J., Jenkins,N.A., Valentine,V., Kirstein,M.N., Shapiro,D.N. and Morris,S.W.
Journal Genomics 33 (2), 277-282 (1996)
Title Assignment of the gene (EPLG2) encoding a high-affinity binding protein for the receptor tyrosine kinase elk to a 200-kilobasepair region in human chromosome Xq12 .
Author Fletcher,F.A., Huebner,K., Shaffer,L.G., Fairweather,N.D., Monaco,A.P., Muller,U., Druck,T., Simoneaux,D.K., Chelly,J., Belmont,J.W. et al.
Journal Genomics 25 (1), 334-335 (1995)
Title Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity .
Author Davis,S., Gale,N.W., Aldrich,T.H., Maisonpierre,P.C., Lhotak,V., Pawson,T., Goldfarb,M. and Yancopoulos,G.D.
Journal Science 266 (5186), 816-819 (1994)
Title Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors .
Author Beckmann,M.P., Cerretti,D.P., Baum,P., Vanden Bos,T., James,L., Farrah,T., Kozlosky,C., Hollingsworth,T., Shilling,H., Maraskovsky,E. et al.
Journal EMBO J. 13 (16), 3757-3762 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.