• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ephrin-B1 (EFNB1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004429 Homo sapiens ephrin-B1 (EFNB1), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_004429.4, 183603932
Length 3344 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ephrin-B1 (EFNB1), mRNA.
Product ephrin-B1 precursor
Comment

Summary: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008].

RefSeq NP_004420.1
CDS 781..1821
Misc Feature(1)250..252
Misc Feature(2)677..688
Misc Feature(3)871..1275
Misc Feature(4)order(955..957,1066..1074,1087..1089,1096..1101,
Misc Feature(5)1492..1554
Misc Feature(6)1525..>1761
Misc Feature(7)1639..1641
Misc Feature(8)1750..1752
Misc Feature(9)1765..1767
Misc Feature(10)1807..1809
Misc Feature(11)1810..1818
Exon (1)1..908
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Exon (2)909..1186
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Exon (3)1187..1279
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Exon (4)1280..1408
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Exon (5)1409..3331
Gene:EFNB1
Gene Synonym:CFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
Translation MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
45..47+dbSNP:
45..47+, ggadbSNP:200409757
86+c, tdbSNP:189750013
273+c, gdbSNP:184030244
396+g, tdbSNP:187341605
552+a, gdbSNP:139698751
759..760+, adbSNP:35579950
788+c, gdbSNP:373904459
889+g, tdbSNP:104894802
890+a, gdbSNP:104894803
913+dbSNP:
913+c, tdbSNP:145603720
941+c, tdbSNP:104894801
942+a, gdbSNP:1056028
972+c, tdbSNP:148907346
976+c, tdbSNP:104894804
991+c, tdbSNP:367996552
1025+a, gdbSNP:370637906
1042+a, gdbSNP:143648191
1112+c, tdbSNP:104894796
1196+dbSNP:
1196+a, tdbSNP:148094474
1202+c, gdbSNP:142430452
1231+a, gdbSNP:28936069
1232+g, tdbSNP:28936070
1241+a, gdbSNP:146636295
1252+a, gdbSNP:28936071
1254+g, tdbSNP:28935170
1289+dbSNP:
1289+c, tdbSNP:147599832
1295+c, tdbSNP:7889678
1296+a, gdbSNP:377269776
1320+g, tdbSNP:143162125
1345+a, gdbSNP:150883256
1346+c, tdbSNP:16989105
1377+g, tdbSNP:200409169
1379+c, gdbSNP:149648624
1425+dbSNP:
1425+a, gdbSNP:144441935
1446+a, gdbSNP:376706341
1465+g, tdbSNP:139138728
1484+a, cdbSNP:369393911
1507+a, gdbSNP:201249059
1512+c, tdbSNP:7890214
1524+c, tdbSNP:376359844
1525+c, gdbSNP:369662868
1539+a, gdbSNP:35567709
1554+a, gdbSNP:373289351
1607+a, gdbSNP:139877825
1608+g, tdbSNP:183532593
1623+a, g, tdbSNP:143341175
1660+a, gdbSNP:376456176
1664+c, tdbSNP:369967894
1671+a, gdbSNP:35202024
1740+c, gdbSNP:370977525
1758+a, cdbSNP:372510064
1771+g, tdbSNP:376262683
1784+c, tdbSNP:370690590
1827+c, tdbSNP:2230423
1881+c, tdbSNP:187874806
1913+c, tdbSNP:192352004
1989+c, gdbSNP:183063780
2125+c, tdbSNP:3196658
2173+c, tdbSNP:41312134
2207..2208+, tdbSNP:201242983
2213+, tdbSNP:35418748
2328+a, gdbSNP:188235570
2390+a, gdbSNP:1804569
2429+g, tdbSNP:1804568
2542..2543+, acdbSNP:71947464
2551+a, cdbSNP:199636325
2551+, cdbSNP:200158453
2552..2553+, cdbSNP:61387446
2553..2554+, c, cacdbSNP:58007755
complement(2553)-t, gdbSNP:16990748
2554..2555+, cdbSNP:57536611
2554+a, cdbSNP:59751961
2555..2556+, cdbSNP:59133604
complement(2555)-t, gdbSNP:688969
2605+c, gdbSNP:367956022
2708+g, tdbSNP:1056069
2715+a, gdbSNP:1056070
2851+c, tdbSNP:199742261
3030+g, tdbSNP:192955667
3085+c, tdbSNP:184659322
3174+c, tdbSNP:375146294
complement(3179)-c, adbSNP:15090
Gene SymbolEFNB1
Gene SynonymCFND; CFNS; EFB1; EFL3; Elk-L; EPLG2; LERK2
ChromosomeX
Locus MapXq12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004429 Homo sapiens ephrin-B1 (EFNB1), mRNA. In-stock $418.00 $369.00 10
Title Targeting ERBB receptors shifts their partners and triggers persistent ERK signaling through a novel ERBB/EFNB1 complex .
Author Vermeer PD, Colbert PL, Wieking BG, Vermeer DW and Lee JH.
Journal Cancer Res. 73 (18), 5787-5797 (2013)
Title Cellular interference in craniofrontonasal syndrome: males mosaic for mutations in the X-linked EFNB1 gene are more severely affected than true hemizygotes .
Author Twigg SR, Babbs C, van den Elzen ME, Goriely A, Taylor S, McGowan SJ, Giannoulatou E, Lonie L, Ragoussis J, Sadighi Akha E, Knight SJ, Zechi-Ceide RM, Hoogeboom JA, Pober BR, Toriello HV, Wall SA, Rita Passos-Bueno M, Brunner HG, Mathijssen IM and Wilkie AO.
Journal Hum. Mol. Genet. 22 (8), 1654-1662 (2013)
Title Nm23-H1 regulates contact inhibition of locomotion, which is affected by ephrin-B1 .
Author Tanaka M, Kuriyama S and Aiba N.
Journal J. Cell. Sci. 125 (PT 18), 4343-4353 (2012)
Title ErbB2, EphrinB1, Src kinase and PTPN13 signaling complex regulates .
Author Vermeer PD, Bell M, Lee K, Vermeer DW, Wieking BG, Bilal E, Bhanot G, Drapkin RI, Ganesan S, Klingelhutz AJ, Hendriks WJ and Lee JH.
Journal PLoS ONE 7 (1), E30447 (2012)
Title Duplication of the EFNB1 gene in familial hypertelorism: imbalance in ephrin-B1 expression and abnormal phenotypes in humans and mice .
Author Babbs C, Stewart HS, Williams LJ, Connell L, Goriely A, Twigg SR, Smith K, Lester T and Wilkie AO.
Journal Hum. Mutat. 32 (8), 930-938 (2011)
Title The genes encoding the eph-related receptor tyrosine kinase ligands LERK-1 (EPLG1, Epl1), LERK-3 (EPLG3, Epl3), and LERK-4 (EPLG4, Epl4) are clustered on human chromosome 1 and mouse chromosome 3 .
Author Cerretti DP, Lyman SD, Kozlosky CJ, Copeland NG, Gilbert DJ, Jenkins NA, Valentine V, Kirstein MN, Shapiro DN and Morris SW.
Journal Genomics 33 (2), 277-282 (1996)
Title Assignment of the gene (EPLG2) encoding a high-affinity binding protein for the receptor tyrosine kinase elk to a 200-kilobasepair region in human chromosome Xq12 .
Author Fletcher FA, Huebner K, Shaffer LG, Fairweather ND, Monaco AP, Muller U, Druck T, Simoneaux DK, Chelly J and Belmont JW.
Journal Genomics 25 (1), 334-335 (1995)
Title Ligands for EPH-related receptor tyrosine kinases that require membrane attachment or clustering for activity .
Author Davis S, Gale NW, Aldrich TH, Maisonpierre PC, Lhotak V, Pawson T, Goldfarb M and Yancopoulos GD.
Journal Science 266 (5186), 816-819 (1994)
Title Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors .
Author Beckmann MP, Cerretti DP, Baum P, Vanden Bos T, James L, Farrah T, Kozlosky C, Hollingsworth T, Shilling H and Maraskovsky E.
Journal EMBO J. 13 (16), 3757-3762 (1994)
Title Congenital Diaphragmatic Hernia Overview .
Author Pober,B.R., Russell,M.K. and Ackerman,K.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.