• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EPH receptor A5 (EPHA5), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu38772 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu38772C Homo sapiens EPH receptor A5 (EPHA5), transcript variant 1, mRNA. Customized vector On-demand $1699.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004439.6, 528881086
Length 3114 bp
Structure linear
Update Date 20-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens EPH receptor A5 (EPHA5), transcript variant 1, mRNA.
Product ephrin type-A receptor 5 isoform a
Comment

Summary: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013].


Transcript Variant: This variant (1) used an alternate splice site in the coding region compared to variant 3. The resulting protein (isoform a) is shorter but has the same N- and C-termini compared to isoform c.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_004430.4
CDS 754..3867
Misc Feature(1)712..714
Misc Feature(2)931..1449
Misc Feature(3)931..1449
Misc Feature(4)order(1003..1005,1009..1023,1042..1047,1051..1053,
Misc Feature(5)1636..1758
Misc Feature(6)1825..2145
Misc Feature(7)order(1825..1827,2050..2052,2089..2091)
Misc Feature(8)order(2092..2097,2101..2106)
Misc Feature(9)2158..2430
Misc Feature(10)order(2158..2160,2347..2349,2392..2394)
Misc Feature(11)order(2395..2400,2404..2409)
Misc Feature(12)2473..2769
Misc Feature(13)2761..3561
Misc Feature(14)2776..3549
Misc Feature(15)order(2794..2796,2800..2808,2818..2820,2866..2868,
Misc Feature(16)order(2794..2796,2803..2808,2866..2868,2872..2874,
Misc Feature(17)order(3151..3153,3163..3165,3262..3276,3301..3303,
Misc Feature(18)3202..3282
Misc Feature(19)3646..3843
Misc Feature(20)3658..3834
Misc Feature(21)order(3697..3699,3796..3798)
Exon (1)1..934
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (2)935..999
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (3)1000..1663
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (4)1664..1819
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (5)1820..2155
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (6)2156..2280
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (7)2281..2440
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (8)2441..2543
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (9)2544..2609
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (10)2610..2677
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (11)2678..2803
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (12)2804..2989
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (13)2990..3051
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (14)3052..3261
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (15)3262..3411
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (16)3412..3605
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (17)3606..3761
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Exon (18)3762..8418
Gene:EPHA5
Gene Synonym:CEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Translation MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP MDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM NSLQEMKVQLVNGMVPL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(136)-dbSNP:
complement(136)-g, adbSNP:143011737
complement(138)-c, adbSNP:377753595
complement(142)-t, cdbSNP:374381125
complement(164)-c, adbSNP:78774773
complement(216)-t, cdbSNP:116476784
complement(223)-g, adbSNP:56390132
complement(315..316)-, adbSNP:201218817
complement(321..322)-, tdbSNP:200537141
complement(349)-g, adbSNP:7678077
complement(388)-t, cdbSNP:191224930
complement(685)-g, adbSNP:186801610
complement(686)-g, adbSNP:138474519
complement(768)-c, adbSNP:56063908
complement(774)-c, adbSNP:183979919
complement(831)-g, cdbSNP:372157288
complement(862)-t, gdbSNP:368790458
complement(898)-c, adbSNP:138631715
complement(930)-g, adbSNP:55860557
complement(946)-dbSNP:
complement(946)-c, adbSNP:141103426
complement(953)-t, cdbSNP:145126637
complement(954)-g, adbSNP:368944082
complement(989)-g, adbSNP:267600206
complement(995)-t, gdbSNP:33932471
complement(995)-c, adbSNP:386481808
complement(1038)-g, adbSNP:140430428
complement(1054)-t, cdbSNP:375311975
complement(1131)-t, gdbSNP:55882537
complement(1156)-g, adbSNP:56375573
complement(1203)-t, gdbSNP:150242892
complement(1212)-t, cdbSNP:370146960
complement(1221)-t, adbSNP:151252926
complement(1253)-t, cdbSNP:374526735
complement(1290)-g, adbSNP:55983743
complement(1378)-t, cdbSNP:202165566
complement(1416)-g, adbSNP:201788539
complement(1437)-t, adbSNP:140823399
complement(1456)-c, adbSNP:55710198
complement(1466)-t, cdbSNP:147719164
complement(1515)-t, cdbSNP:145600203
complement(1533)-g, adbSNP:34680587
complement(1540)-t, cdbSNP:371073025
complement(1557)-t, gdbSNP:373719926
complement(1584)-g, adbSNP:377555731
complement(1588)-t, cdbSNP:369606981
complement(1604)-c, adbSNP:202003158
complement(1638)-g, adbSNP:144854903
complement(1677)-dbSNP:
complement(1677)-t, cdbSNP:149857749
complement(1700)-g, adbSNP:150719652
complement(1711)-c, adbSNP:375878596
complement(1720)-t, gdbSNP:141630624
complement(1741)-g, cdbSNP:56205382
complement(1796)-t, cdbSNP:200932017
complement(1807)-t, cdbSNP:369361168
complement(1846)-dbSNP:
complement(1846)-t, cdbSNP:372046653
complement(1891)-g, adbSNP:199650353
complement(1955)-t, gdbSNP:372600904
complement(1979)-t, cdbSNP:201779427
complement(1980)-g, adbSNP:199891992
complement(1981)-t, cdbSNP:200754741
complement(2002)-g, adbSNP:202046693
complement(2003)-t, c, adbSNP:199614818
complement(2011)-t, cdbSNP:370503988
complement(2018)-t, adbSNP:138620350
complement(2029)-t, cdbSNP:371755476
complement(2049)-g, adbSNP:368578311
complement(2091)-t, gdbSNP:145994427
complement(2097)-g, adbSNP:375581443
complement(2098)-t, cdbSNP:370633345
complement(2101)-c, adbSNP:142589245
complement(2142)-g, cdbSNP:148039179
complement(2159)-dbSNP:
complement(2159)-g, adbSNP:372519544
complement(2165)-g, adbSNP:143584300
complement(2168)-c, adbSNP:374481112
complement(2219)-t, cdbSNP:370102571
complement(2233)-g, adbSNP:138678484
complement(2247)-g, adbSNP:377073108
complement(2256)-t, cdbSNP:376952898
complement(2270)-t, cdbSNP:56074660
complement(2301)-dbSNP:
complement(2301)-t, cdbSNP:368999628
complement(2321)-t, gdbSNP:201024355
complement(2335)-g, cdbSNP:77407591
complement(2337)-t, cdbSNP:142424482
complement(2355)-t, cdbSNP:371309035
complement(2364)-g, adbSNP:202074075
complement(2379)-t, cdbSNP:112262392
complement(2394)-t, gdbSNP:183969601
complement(2418)-g, adbSNP:367704412
complement(2443)-dbSNP:
complement(2443)-t, cdbSNP:376412603
complement(2452)-t, cdbSNP:147702842
complement(2479)-c, adbSNP:142184664
complement(2487)-t, adbSNP:200246054
complement(2488)-t, cdbSNP:373360876
complement(2513)-g, adbSNP:140536477
complement(2551)-dbSNP:
complement(2551)-t, cdbSNP:151302542
complement(2562)-c, adbSNP:116814255
complement(2566)-t, cdbSNP:75466484
complement(2583)-g, adbSNP:200675919
complement(2611)-dbSNP:
complement(2611)-t, gdbSNP:146757388
complement(2613)-t, cdbSNP:368212712
complement(2619)-t, gdbSNP:142432236
complement(2676)-g, adbSNP:374702019
complement(2718)-dbSNP:
complement(2718)-g, adbSNP:374583083
complement(2732)-t, cdbSNP:200980371
complement(2754)-g, adbSNP:35363653
complement(2767)-t, cdbSNP:36050417
complement(2770)-t, adbSNP:56359290
complement(2905)-dbSNP:
complement(2905)-g, adbSNP:201120003
complement(2921)-g, cdbSNP:374393697
complement(2984)-g, adbSNP:143201043
complement(2997)-dbSNP:
complement(2997)-t, cdbSNP:199720107
complement(3006)-g, adbSNP:200235221
complement(3015)-t, cdbSNP:374791567
complement(3101)-dbSNP:
complement(3101)-g, cdbSNP:199801676
complement(3142)-c, adbSNP:369412311
complement(3181)-t, cdbSNP:371973459
complement(3236)-t, cdbSNP:374985302
complement(3240)-g, adbSNP:139853168
complement(3252)-g, adbSNP:145959986
complement(3255)-g, adbSNP:371238908
complement(3312)-dbSNP:
complement(3312)-t, gdbSNP:142469673
complement(3327)-g, adbSNP:201353014
complement(3354)-t, cdbSNP:112373473
complement(3359)-t, cdbSNP:138014411
complement(3396)-t, cdbSNP:372762875
complement(3397)-t, cdbSNP:201970590
3423+dbSNP:
3423+a, gdbSNP:3752773
complement(3426)-t, cdbSNP:139495389
complement(3444)-t, cdbSNP:141346857
complement(3453)-g, adbSNP:148284158
complement(3503)-t, adbSNP:367883786
complement(3508)-g, adbSNP:146343247
complement(3513)-g, adbSNP:375324566
complement(3552)-g, adbSNP:200045329
complement(3562)-g, adbSNP:142359231
complement(3571)-t, gdbSNP:200462532
complement(3598)-t, adbSNP:181148552
complement(3606)-dbSNP:
complement(3606)-t, adbSNP:377047530
complement(3622)-t, cdbSNP:373548243
complement(3628)-g, cdbSNP:200305031
complement(3629)-t, cdbSNP:56312931
complement(3648)-t, cdbSNP:7349683
complement(3731)-g, adbSNP:74487329
complement(3738)-g, adbSNP:188116759
complement(3742)-c, adbSNP:147053536
complement(3746)-g, adbSNP:183192179
complement(3756)-g, adbSNP:371489573
complement(3759)-t, cdbSNP:200855979
complement(3771)-dbSNP:
complement(3771)-t, cdbSNP:143311758
complement(3773)-t, cdbSNP:145811811
complement(3793)-t, cdbSNP:149835568
complement(3816)-g, adbSNP:141088985
complement(3819)-g, adbSNP:56037197
complement(3837)-t, cdbSNP:190296017
complement(3839)-t, cdbSNP:144528528
complement(3850)-t, cdbSNP:139793674
complement(3853)-t, adbSNP:200525613
complement(3858)-c, adbSNP:374606916
complement(3864)-t, cdbSNP:55784741
complement(3879)-g, adbSNP:199557544
complement(3882)-g, adbSNP:370996010
complement(3883)-t, cdbSNP:111816056
3924+c, tdbSNP:143895090
complement(3944)-t, cdbSNP:77062137
complement(3945..3946)-, tdbSNP:111537275
complement(3994)-g, adbSNP:111918199
complement(4092)-c, adbSNP:188856439
complement(4234)-g, adbSNP:186366641
complement(4303..4304)-, ttdbSNP:34246462
complement(4439)-g, cdbSNP:7688795
complement(4542)-g, cdbSNP:182262264
complement(4715)-g, adbSNP:80050373
complement(4843)-g, adbSNP:377484582
complement(4869)-g, adbSNP:189217074
complement(4933)-t, gdbSNP:149422043
complement(4946)-t, cdbSNP:34509814
5027+c, gdbSNP:1451184
complement(5036)-t, cdbSNP:367862046
complement(5039..5040)-, adbSNP:34032079
complement(5054)-c, adbSNP:10155327
complement(5162)-t, cdbSNP:74972138
complement(5178)-g, adbSNP:73824282
complement(5205)-t, cdbSNP:56094753
complement(5230)-t, gdbSNP:184270703
complement(5361)-t, cdbSNP:180817985
complement(5404)-t, cdbSNP:4860651
complement(5435)-t, adbSNP:188804150
complement(5539)-g, adbSNP:184068208
complement(5635)-c, adbSNP:368347295
complement(5650)-c, adbSNP:79534174
complement(5707)-g, adbSNP:371395978
complement(5875)-g, adbSNP:28580139
complement(5890)-g, adbSNP:192237920
complement(6072)-g, adbSNP:4860650
complement(6224)-g, adbSNP:144004477
6238+c, tdbSNP:1376426
complement(6288)-, tdbSNP:376653311
complement(6370)-t, cdbSNP:111748696
complement(6400)-t, cdbSNP:78953182
complement(6410)-t, adbSNP:185589716
complement(6494)-t, cdbSNP:115670792
complement(6530)-t, adbSNP:193205873
6581+c, tdbSNP:147062149
complement(6597)-t, cdbSNP:370354587
complement(6599..6600)-gg, acdbSNP:386675381
complement(6599)-g, cdbSNP:73824281
complement(6600)-g, adbSNP:73824279
complement(6685)-, adbSNP:145254769
complement(6709)-t, gdbSNP:140511519
complement(6772)-g, adbSNP:375950346
complement(6774)-g, adbSNP:188758788
complement(6791)-t, cdbSNP:183014781
complement(6803)-t, cdbSNP:372946430
complement(6819)-t, gdbSNP:76925001
6885+c, tdbSNP:148294196
complement(6918)-t, cdbSNP:73824278
complement(7107)-g, adbSNP:189660116
complement(7147)-t, cdbSNP:375032473
complement(7176)-t, cdbSNP:372831808
complement(7208)-g, adbSNP:187112036
complement(7214)-t, cdbSNP:182434623
complement(7313)-g, adbSNP:190570491
complement(7363)-t, cdbSNP:113178198
complement(7453)-c, adbSNP:369474033
complement(7539..7540)-, tdbSNP:11376233
complement(7580)-t, cdbSNP:4860649
complement(7654..7656)-, tcadbSNP:10538273
complement(7656..7657)-, tcadbSNP:141281063
complement(7682)-g, adbSNP:4860648
complement(7764)-t, cdbSNP:182146200
complement(7811)-t, adbSNP:192510299
complement(7829)-g, adbSNP:187124666
complement(7884)-c, adbSNP:80169835
complement(7971)-c, adbSNP:149103918
complement(7983)-g, adbSNP:146517923
complement(7984)-t, cdbSNP:76455416
complement(8049..8051)-, ctadbSNP:367597283
complement(8057)-g, adbSNP:180965980
complement(8315)-g, adbSNP:188162267
Gene SymbolEPHA5
Gene SynonymCEK7; EHK-1; EHK1; EK7; HEK7; TYRO4
Chromosome4
Locus Map4q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001281767 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 5, mRNA. On-demand TBD TBD
NM_001281765 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 3, mRNA. On-demand TBD TBD
NM_004439 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 1, mRNA. On-demand TBD TBD
NM_182472 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 2, mRNA. On-demand TBD TBD
NM_001281766 Homo sapiens EPH receptor A5 (EPHA5), transcript variant 4, mRNA. On-demand TBD TBD
XM_005265653 PREDICTED: Homo sapiens EPH receptor A5 (EPHA5), transcript variant X4, mRNA. On-demand TBD TBD
Title Insertional translocation leading to a 4q13 duplication including the EPHA5 gene in two siblings with attention-deficit hyperactivity disorder .
Author Matoso E, Melo JB, Ferreira SI, Jardim A, Castelo TM, Weise A and Carreira IM.
Journal Am. J. Med. Genet. A 161A (8), 1923-1928 (2013)
Title MicroRNA-34a regulates migration of chondroblast and IL-1beta-induced degeneration of chondrocytes by targeting EphA5 .
Author Kim D, Song J, Kim S, Chun CH and Jin EJ.
Journal Biochem. Biophys. Res. Commun. 415 (4), 551-557 (2011)
Title Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure .
Author Lingappa JR, Petrovski S, Kahle E, Fellay J, Shianna K, McElrath MJ, Thomas KK, Baeten JM, Celum C, Wald A, de Bruyn G, Mullins JI, Nakku-Joloba E, Farquhar C, Essex M, Donnell D, Kiarie J, Haynes B and Goldstein D.
Journal PLoS ONE 6 (12), E28632 (2011)
Title Clinical significance of ephrin (eph)-A1, -A2, -a4, -a5 and -a7 receptors in pancreatic ductal adenocarcinoma .
Author Giaginis C, Tsourouflis G, Zizi-Serbetzoglou A, Kouraklis G, Chatzopoulou E, Dimakopoulou K and Theocharis SE.
Journal Pathol. Oncol. Res. 16 (2), 267-276 (2010)
Title A link between axon guidance and axon fasciculation suggested by studies of the tyrosine kinase receptor EphA5/REK7 and its ligand ephrin-A5/AL-1 .
Author Caras IW.
Journal Cell Tissue Res. 290 (2), 261-264 (1997)
Title Regulation of topographic projection by the Eph family receptor Bsk (EphA5) and its ligands .
Author Zhou R.
Journal Cell Tissue Res. 290 (2), 251-259 (1997)
Title Extensive splice variation and localization of the EHK-1 receptor tyrosine kinase in adult human brain and glial tumors .
Author Miescher GC, Taylor V, Olivieri G, Mindermann T, Schrock E and Steck AJ.
Journal Brain Res. Mol. Brain Res. 46 (1-2), 17-24 (1997)
Title Eph receptors and ligands comprise two major specificity subclasses and are reciprocally compartmentalized during embryogenesis .
Author Gale NW, Holland SJ, Valenzuela DM, Flenniken A, Pan L, Ryan TE, Henkemeyer M, Strebhardt K, Hirai H, Wilkinson DG, Pawson T, Davis
Journal Neuron 17 (1), 9-19 (1996)
Title cDNA cloning and tissue distribution of five human EPH-like receptor protein-tyrosine kinases .
Author Fox GM, Holst PL, Chute HT, Lindberg RA, Janssen AM, Basu R and Welcher AA.
Journal Oncogene 10 (5), 897-905 (1995)
Title A YAC contig spanning a cluster of human type III receptor protein tyrosine kinase genes (PDGFRA-KIT-KDR) in chromosome segment 4q12 .
Author Spritz RA, Strunk KM, Lee ST, Lu-Kuo JM, Ward DC, Le Paslier D, Altherr MR, Dorman TE and Moir DT.
Journal Genomics 22 (2), 431-436 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.