• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EPH receptor B4 (EPHB4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu13402 Homo sapiens EPH receptor B4 (EPHB4), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu13402C Homo sapiens EPH receptor B4 (EPHB4), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004444.4, 55774978
Length 2964 bp
Structure linear
Update Date 23-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens EPH receptor B4 (EPHB4), mRNA.
Product ephrin type-B receptor 4 precursor
Comment

Summary: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene binds to ephrin-B2 and plays an essential role in vascular development. [provided by RefSeq, Jul 2008].

RefSeq NP_004435.3
CDS 492..3455
Misc Feature(1)480..482
Misc Feature(2)540..1079
Misc Feature(3)order(570..572,576..578,618..629,633..641,645..647,
Misc Feature(4)1206..1454
Misc Feature(5)order(1206..1211,1317..1319,1347..1349,1419..1421)
Misc Feature(6)order(1218..1220,1248..1250,1260..1262,1266..1268,
Misc Feature(7)order(1248..1277,1287..1301,1362..1370)
Misc Feature(8)1281..1388
Misc Feature(9)order(1326..1331,1344..1352)
Misc Feature(10)order(1419..1421,1443..1454)
Misc Feature(11)1461..1778
Misc Feature(12)order(1461..1463,1683..1685,1728..1730)
Misc Feature(13)order(1740..1745,1752..1757)
Misc Feature(14)1791..2069
Misc Feature(15)order(1791..1793,1986..1988,2031..2033)
Misc Feature(16)order(2034..2039,2043..2048)
Misc Feature(17)2109..2171
Misc Feature(18)<2181..2327
Misc Feature(19)2319..3125
Misc Feature(20)2334..3113
Misc Feature(21)order(2352..2366,2376..2378,2424..2426,2430..2432,
Misc Feature(22)order(2352..2360,2364..2366,2376..2378,2424..2426,
Misc Feature(23)order(2709..2711,2721..2723,2826..2840,2865..2867,
Misc Feature(24)2760..2846
Misc Feature(25)3201..3404
Misc Feature(26)3210..3410
Misc Feature(27)3222..3224
Misc Feature(28)order(3261..3263,3360..3362)
Misc Feature(29)3417..3419
Misc Feature(30)3444..3452
Misc Feature(31)3450..3452
Exon (1)1..543
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (2)544..614
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (3)615..902
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (4)903..1299
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (5)1300..1455
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (6)1456..1788
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (7)1789..1913
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (8)1914..2079
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (9)2080..2182
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (10)2183..2247
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (11)2248..2361
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (12)2362..2609
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (13)2610..2825
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (14)2826..2975
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (15)2976..3169
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (16)3170..3325
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (17)3326..4351
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Translation MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK ILASVQHMKSQAKPGTPGGTGGPAPQY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(206)-dbSNP:
complement(206)-t, gdbSNP:189006064
complement(229)-g, adbSNP:183661477
complement(368)-g, cdbSNP:2571606
complement(417)-g, adbSNP:116409758
complement(465)-g, adbSNP:374017664
complement(477)-c, adbSNP:370335830
complement(504)-t, cdbSNP:376314076
complement(519)-c, adbSNP:373130748
complement(531)-t, cdbSNP:139513482
complement(549)-dbSNP:
complement(549)-g, adbSNP:372997648
complement(554)-t, cdbSNP:369342830
complement(564)-g, adbSNP:144551580
complement(624)-dbSNP:
complement(624)-g, cdbSNP:149287966
complement(653)-g, adbSNP:3735694
complement(683)-t, cdbSNP:369941952
complement(684)-g, adbSNP:375154133
complement(691)-g, adbSNP:34653459
complement(692)-t, cdbSNP:138656609
complement(712)-t, cdbSNP:61735971
complement(737)-g, adbSNP:373788065
complement(738)-t, cdbSNP:371690893
complement(741)-t, cdbSNP:201465765
complement(758)-t, cdbSNP:150582750
complement(762)-g, adbSNP:367658028
complement(771)-t, cdbSNP:34745261
complement(795)-g, adbSNP:141985925
complement(808)-g, adbSNP:199871056
complement(824)-g, adbSNP:374873829
complement(828)-t, cdbSNP:55866373
complement(845)-g, adbSNP:200452203
complement(846)-t, cdbSNP:201416777
complement(851)-t, cdbSNP:377679562
complement(857)-t, cdbSNP:146092347
complement(863)-t, cdbSNP:202126100
complement(869)-g, adbSNP:145080354
complement(871)-g, adbSNP:142856240
complement(910)-dbSNP:
complement(910)-g, adbSNP:200549250
complement(956)-g, adbSNP:201197431
complement(976)-t, cdbSNP:17854760
complement(980)-t, cdbSNP:61130921
complement(1037)-g, adbSNP:56173078
complement(1055)-t, cdbSNP:201682575
complement(1059)-g, cdbSNP:371330707
complement(1083)-t, cdbSNP:112443300
complement(1114)-g, adbSNP:111749768
complement(1115)-c, adbSNP:200156491
complement(1129)-t, cdbSNP:377700390
complement(1145)-g, adbSNP:372433130
complement(1151)-g, adbSNP:200580904
complement(1173)-t, cdbSNP:146902369
complement(1179)-t, cdbSNP:142009811
complement(1182)-g, adbSNP:147563837
complement(1194)-g, adbSNP:200701924
complement(1229)-g, adbSNP:374800831
complement(1293)-c, adbSNP:201816920
complement(1329)-dbSNP:
complement(1329)-g, adbSNP:144988774
complement(1339)-t, cdbSNP:201531252
complement(1364..1365)-, adbSNP:372152997
complement(1364)-g, adbSNP:376169261
complement(1391)-g, adbSNP:143853125
complement(1399)-t, cdbSNP:61735974
complement(1406)-g, adbSNP:139571805
complement(1409)-g, adbSNP:151161414
complement(1473)-dbSNP:
complement(1473)-t, gdbSNP:199701655
complement(1478)-g, adbSNP:200232840
complement(1508)-c, adbSNP:55867842
complement(1528)-g, adbSNP:267601191
1543+c, tdbSNP:77303848
complement(1558)-g, cdbSNP:192640017
complement(1569)-g, adbSNP:201467689
complement(1570)-t, cdbSNP:202006098
complement(1587)-g, cdbSNP:369954495
complement(1589)-g, adbSNP:375470820
complement(1603)-g, adbSNP:55720981
complement(1612)-t, cdbSNP:372148087
complement(1634)-g, adbSNP:2289058
complement(1635)-t, cdbSNP:114926839
complement(1672)-t, cdbSNP:373471680
complement(1722)-t, cdbSNP:144185458
complement(1730)-g, adbSNP:369114721
complement(1742)-t, cdbSNP:202220624
complement(1743)-t, cdbSNP:371835903
complement(1745)-t, cdbSNP:55843039
complement(1748)-g, adbSNP:369885905
complement(1749)-t, cdbSNP:61735975
complement(1768)-t, cdbSNP:376809512
complement(1783)-g, cdbSNP:74779801
complement(1805)-dbSNP:
complement(1805)-t, cdbSNP:144173
complement(1805)-t, cdbSNP:386532040
complement(1819)-g, adbSNP:183759430
complement(1821)-g, adbSNP:370505170
complement(1822)-c, adbSNP:146064780
complement(1823)-c, adbSNP:142736543
complement(1847)-g, cdbSNP:150291524
complement(1848)-t, cdbSNP:138234752
complement(1849)-g, adbSNP:150425369
complement(1863)-g, adbSNP:141544967
complement(1871)-g, adbSNP:148350653
complement(1875)-t, cdbSNP:146674844
complement(1879)-t, gdbSNP:7457245
complement(1902)-c, adbSNP:3891495
complement(1905)-g, adbSNP:149712104
complement(1916)-dbSNP:
complement(1916)-g, adbSNP:370067368
complement(1934)-g, adbSNP:142650086
complement(1952)-t, cdbSNP:375034189
complement(1962)-t, gdbSNP:371751665
complement(1965)-t, cdbSNP:147737164
complement(1975)-t, cdbSNP:200691435
complement(2017)-g, cdbSNP:146937374
complement(2045)-g, adbSNP:148818692
complement(2084)-dbSNP:
complement(2084)-g, adbSNP:55682161
complement(2089)-c, adbSNP:149690566
complement(2095)-t, cdbSNP:139594739
complement(2116)-g, adbSNP:201096509
complement(2123)-t, cdbSNP:201252094
complement(2134)-c, adbSNP:370425633
complement(2172)-g, cdbSNP:199707528
complement(2215)-dbSNP:
complement(2215)-g, adbSNP:60537976
complement(2216)-t, cdbSNP:373064420
complement(2219)-g, cdbSNP:36050247
complement(2234)-g, adbSNP:116240595
2243+a, gdbSNP:314359
complement(2244)-g, adbSNP:78081360
complement(2290)-dbSNP:
complement(2290)-t, cdbSNP:139432679
complement(2381)-dbSNP:
complement(2381)-t, cdbSNP:386561786
2381+c, tdbSNP:2230585
complement(2396)-c, adbSNP:374676243
complement(2447)-g, adbSNP:183383429
complement(2449)-t, adbSNP:199997663
complement(2458)-t, cdbSNP:201283096
complement(2463)-g, adbSNP:142798266
complement(2515)-t, cdbSNP:148505212
complement(2524)-t, cdbSNP:55692440
complement(2534)-g, adbSNP:200520910
complement(2555)-g, adbSNP:374636619
complement(2571)-t, cdbSNP:58976385
complement(2579)-t, cdbSNP:144756820
complement(2584)-t, adbSNP:369790197
complement(2588)-g, adbSNP:149377356
complement(2611)-dbSNP:
complement(2611)-t, adbSNP:369745443
complement(2616)-t, cdbSNP:202157491
complement(2619)-t, cdbSNP:375150649
complement(2642)-g, adbSNP:112613465
complement(2652)-g, cdbSNP:372257470
complement(2669)-t, cdbSNP:199591006
complement(2699)-g, adbSNP:201350870
complement(2743)-t, adbSNP:200376692
complement(2748)-t, cdbSNP:368484374
complement(2771)-g, adbSNP:373776011
complement(2783)-t, gdbSNP:371509217
complement(2801)-g, adbSNP:147302485
complement(2813)-g, adbSNP:143966632
complement(2815)-g, adbSNP:367628554
complement(2818..2819)-, adbSNP:35809853
complement(2822)-g, cdbSNP:374120458
complement(2840)-dbSNP:
complement(2840)-g, adbSNP:267601190
complement(2858)-t, cdbSNP:377653260
complement(2874)-g, adbSNP:375461456
complement(2888)-g, adbSNP:201140601
complement(2909)-g, adbSNP:377702127
complement(2921)-t, cdbSNP:199910843
complement(2948)-t, cdbSNP:201929093
complement(2951)-t, cdbSNP:138574211
complement(2965)-t, cdbSNP:147110749
complement(2975)-g, adbSNP:369079556
complement(3006)-dbSNP:
complement(3006)-g, adbSNP:140135838
complement(3079)-g, adbSNP:375175851
complement(3080)-g, cdbSNP:148193109
complement(3108)-t, cdbSNP:201842419
complement(3135)-t, cdbSNP:34918225
complement(3149)-g, adbSNP:149061889
complement(3157)-t, cdbSNP:146445434
complement(3161)-c, adbSNP:35638378
complement(3168)-t, cdbSNP:140332222
complement(3169)-c, adbSNP:146768192
complement(3173)-dbSNP:
complement(3173)-g, cdbSNP:371478366
complement(3189)-g, cdbSNP:200795996
complement(3195)-g, adbSNP:200953030
complement(3200)-t, cdbSNP:149744160
complement(3202)-g, cdbSNP:372947329
complement(3209)-g, cdbSNP:370570826
complement(3212)-t, cdbSNP:139596649
complement(3266)-t, cdbSNP:372770508
3269+a, cdbSNP:1056997
complement(3271)-t, cdbSNP:199674277
complement(3275)-g, adbSNP:200688295
complement(3337)-dbSNP:
complement(3337)-t, cdbSNP:373446670
complement(3355)-g, adbSNP:139196073
complement(3440)-c, adbSNP:112803997
complement(3445)-g, adbSNP:140842916
complement(3446)-t, cdbSNP:56086910
complement(3471)-g, adbSNP:192294324
complement(3486)-t, cdbSNP:199872533
complement(3500)-g, adbSNP:371147602
3508+a, cdbSNP:1056999
complement(3593..3594)-, tcdbSNP:113576131
complement(3635)-g, adbSNP:201276061
complement(3769)-t, cdbSNP:188396001
complement(3775)-t, cdbSNP:112333978
complement(3807)-t, cdbSNP:386465062
complement(3807)-g, adbSNP:146906933
complement(3816)-c, adbSNP:184730214
complement(3884)-g, cdbSNP:56326327
complement(3884)-g, cdbSNP:386499976
complement(3896)-g, adbSNP:144057522
complement(4022)-g, adbSNP:76600840
complement(4083)-t, cdbSNP:3735693
complement(4102)-g, adbSNP:79415738
complement(4119)-g, cdbSNP:138315905
complement(4197)-t, cdbSNP:192741390
complement(4232)-t, cdbSNP:376792022
complement(4241)-t, cdbSNP:143643119
complement(4244)-t, cdbSNP:187750973
complement(4261)-t, cdbSNP:182382342
Gene SymbolEPHB4
Gene SynonymHTK; MYK1; TYRO11
Chromosome7
Locus Map7q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004444 Homo sapiens EPH receptor B4 (EPHB4), mRNA. On-demand $279.00 12-14
Title Eph receptor B4 is a regulator of estrogen receptor alpha in breast cancer cells .
Author Schmitt F, Nguyen PH, Gupta N and Mayer D.
Journal J. Recept. Signal Transduct. Res. 33 (4), 244-248 (2013)
Title The EphB4 receptor tyrosine kinase promotes lung cancer growth: a potential novel therapeutic target .
Author Ferguson BD, Liu R, Rolle CE, Tan YH, Krasnoperov V, Kanteti R, Tretiakova MS, Cervantes GM, Hasina R, Hseu RD, Iafrate AJ, Karrison T, Ferguson MK, Husain AN, Faoro L, Vokes EE, Gill PS and Salgia R.
Journal PLoS ONE 8 (7), E67668 (2013)
Title Correlation between erythropoietin receptor(s) and estrogen and progesterone receptor expression in different breast cancer cell lines .
Author Trost N, Hevir N, Rizner TL and Debeljak N.
Journal Int. J. Mol. Med. 31 (3), 717-725 (2013)
Title EphB4 as a therapeutic target in mesothelioma .
Author Liu R, Ferguson BD, Zhou Y, Naga K, Salgia R, Gill PS and Krasnoperov V.
Journal BMC Cancer 13, 269 (2013)
Title Gene expression profiling identifies EPHB4 as a potential predictive biomarker in colorectal cancer patients treated with bevacizumab .
Author Guijarro-Munoz I, Sanchez A, Martinez-Martinez E, Garcia JM, Salas C, Provencio M, Alvarez-Vallina L and Sanz L.
Journal Med. Oncol. 30 (2), 572 (2013)
Title The Eph family receptors and ligands .
Author Zhou R.
Journal Pharmacol. Ther. 77 (3), 151-181 (1998)
Title The ephrins and Eph receptors in neural development .
Author Flanagan JG and Vanderhaeghen P.
Journal Annu. Rev. Neurosci. 21, 309-345 (1998)
Title Expression of the receptor protein tyrosine kinase myk-1/htk in normal and malignant mammary epithelium .
Author Berclaz G, Andres AC, Albrecht D, Dreher E, Ziemiecki A, Gusterson
Journal Biochem. Biophys. Res. Commun. 226 (3), 869-875 (1996)
Title Cloning and characterization of HTK, a novel transmembrane tyrosine kinase of the EPH subfamily .
Author Bennett BD, Wang Z, Kuang WJ, Wang A, Groopman JE, Goeddel DV and Scadden DT.
Journal J. Biol. Chem. 269 (19), 14211-14218 (1994)
Title Expression of two novel eph-related receptor protein tyrosine kinases in mammary gland development and carcinogenesis .
Author Andres AC, Reid HH, Zurcher G, Blaschke RJ, Albrecht D and Ziemiecki A.
Journal Oncogene 9 (5), 1461-1467 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.