Homo sapiens EPH receptor B4 (EPHB4), mRNA.
| RefSeq Version | NM_004444.4, 55774978 |
| Length | 4369 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens EPH receptor B4 (EPHB4), mRNA. |
| Product | ephrin type-B receptor 4 precursor |
| Comment | Summary: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene binds to ephrin-B2 and plays an essential role in vascular development. [provided by RefSeq]. |
| RefSeq | NP_004435.3 |
| CDS | 492..3455 | Exon (1) | 1..543 | Exon (2) | 1..543 | Exon (3) | 544..614 | Exon (4) | 615..902 | Exon (5) | 903..1299 | Exon (6) | 1300..1455 | Exon (7) | 1456..1788 | Exon (8) | 1789..1913 | Exon (9) | 1914..2079 | Exon (10) | 2080..2182 | Exon (11) | 2183..2247 | Exon (12) | 2248..2361 | Exon (13) | 2362..2609 | Exon (14) | 2610..2825 | Exon (15) | 2826..2975 | Exon (16) | 2976..3169 | Exon (17) | 3170..3325 | Exon (18) | 3326..4351 |
| Translation | MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(368) | - | g, c | dbSNP:2571606 |
| complement(417) | - | g, a | dbSNP:116409758 |
| complement(653) | - | g, a | dbSNP:3735694 |
| complement(691) | - | g, a | dbSNP:34653459 |
| complement(712) | - | t, c | dbSNP:61735971 |
| complement(771) | - | t, c | dbSNP:34745261 |
| complement(828) | - | t, c | dbSNP:55866373 |
| complement(976) | - | t, c | dbSNP:17854760 |
| complement(980) | - | t, c | dbSNP:61130921 |
| complement(1037) | - | g, a | dbSNP:56173078 |
| complement(1083) | - | t, c | dbSNP:112443300 |
| complement(1114) | - | g, a | dbSNP:111749768 |
| complement(1399) | - | t, c | dbSNP:61735974 |
| complement(1508) | - | c, a | dbSNP:55867842 |
| complement(1543) | - | t, c | dbSNP:77303848 |
| complement(1603) | - | g, a | dbSNP:55720981 |
| complement(1634) | - | g, a | dbSNP:2289058 |
| complement(1635) | - | t, c | dbSNP:114926839 |
| complement(1745) | - | t, c | dbSNP:55843039 |
| complement(1749) | - | t, c | dbSNP:61735975 |
| complement(1783) | - | g, c | dbSNP:74779801 |
| 1805 | + | c, t | dbSNP:144173 |
| complement(1879) | - | t, g | dbSNP:7457245 |
| complement(1902) | - | c, a | dbSNP:3891495 |
| complement(2084) | - | g, a | dbSNP:55682161 |
| complement(2215) | - | g, a | dbSNP:60537976 |
| complement(2219) | - | g, c | dbSNP:36050247 |
| complement(2234) | - | g, a | dbSNP:116240595 |
| 2243 | + | a, g | dbSNP:314359 |
| complement(2244) | - | g, a | dbSNP:78081360 |
| 2381 | + | c, t | dbSNP:2230585 |
| complement(2524) | - | t, c | dbSNP:55692440 |
| complement(2571) | - | t, c | dbSNP:58976385 |
| complement(2642) | - | g, a | dbSNP:112613465 |
| complement(2818..2819) | - | , a | dbSNP:35809853 |
| complement(3135) | - | t, c | dbSNP:34918225 |
| complement(3161) | - | c, a | dbSNP:35638378 |
| 3269 | + | a, c | dbSNP:1056997 |
| complement(3440) | - | c, a | dbSNP:112803997 |
| complement(3446) | - | t, c | dbSNP:56086910 |
| complement(3495) | - | , a | dbSNP:67087640 |
| 3508 | + | a, c | dbSNP:1056999 |
| complement(3590) | - | , tc | dbSNP:113576131 |
| complement(3775) | - | t, c | dbSNP:112333978 |
| complement(3884) | - | g, c | dbSNP:56326327 |
| complement(4022) | - | g, a | dbSNP:76600840 |
| complement(4083) | - | t, c | dbSNP:3735693 |
| complement(4102) | - | g, a | dbSNP:79415738 |
| Title | Over-expression of Ephb4 is associated with carcinogenesis of gastric cancer . |
| Author | Li,M., Zhao,Z.W., Zhang,Y. and Xin,Y. |
| Journal | Dig. Dis. Sci. 56 (3), 698-706 (2011) |
| Title | Novel EphB4 monoclonal antibodies modulate angiogenesis and inhibit tumor growth . |
| Author | Krasnoperov,V., Kumar,S.R., Ley,E., Li,X., Scehnet,J., Liu,R., Zozulya,S. and Gill,P.S. |
| Journal | Am. J. Pathol. 176 (4), 2029-2038 (2010) |
| Title | Aberrant DNA methylation and epigenetic inactivation of Eph receptor tyrosine kinases and ephrin ligands in acute lymphoblastic leukemia . |
| Author | Kuang,S.Q., Bai,H., Fang,Z.H., Lopez,G., Yang,H., Tong,W., Wang,Z.Z. and Garcia-Manero,G. |
| Journal | Blood 115 (12), 2412-2419 (2010) |
| Title | BCR-ABL-independent and RAS / MAPK pathway-dependent form of imatinib resistance in Ph-positive acute lymphoblastic leukemia cell line with activation of EphB4 . |
| Author | Suzuki,M., Abe,A., Imagama,S., Nomura,Y., Tanizaki,R., Minami,Y., Hayakawa,F., Ito,Y., Katsumi,A., Yamamoto,K., Emi,N., Kiyoi,H. and Naoe,T. |
| Journal | Eur. J. Haematol. 84 (3), 229-238 (2010) |
| Title | EPHB4 gene polymorphisms and risk of intracranial hemorrhage in patients with brain arteriovenous malformations . |
| Author | Weinsheimer,S., Kim,H., Pawlikowska,L., Chen,Y., Lawton,M.T., Sidney,S., Kwok,P.Y., McCulloch,C.E. and Young,W.L. |
| Journal | Circ Cardiovasc Genet 2 (5), 476-482 (2009) |
| Title | The Eph family receptors and ligands . |
| Author | Zhou,R. |
| Journal | Pharmacol. Ther. 77 (3), 151-181 (1998) |
| Title | The ephrins and Eph receptors in neural development . |
| Author | Flanagan,J.G. and Vanderhaeghen,P. |
| Journal | Annu. Rev. Neurosci. 21, 309-345 (1998) |
| Title | Expression of the receptor protein tyrosine kinase myk-1/htk in normal and malignant mammary epithelium . |
| Author | Berclaz,G., Andres,A.C., Albrecht,D., Dreher,E., Ziemiecki,A., Gusterson,B.A. and Crompton,M.R. |
| Journal | Biochem. Biophys. Res. Commun. 226 (3), 869-875 (1996) |
| Title | Cloning and characterization of HTK, a novel transmembrane tyrosine kinase of the EPH subfamily . |
| Author | Bennett,B.D., Wang,Z., Kuang,W.J., Wang,A., Groopman,J.E., Goeddel,D.V. and Scadden,D.T. |
| Journal | J. Biol. Chem. 269 (19), 14211-14218 (1994) |
| Title | Expression of two novel eph-related receptor protein tyrosine kinases in mammary gland development and carcinogenesis . |
| Author | Andres,A.C., Reid,H.H., Zurcher,G., Blaschke,R.J., Albrecht,D. and Ziemiecki,A. |
| Journal | Oncogene 9 (5), 1461-1467 (1994) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |