• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EPH receptor B4 (EPHB4), mRNA.


RefSeq Accession Definition Services Price Order
NM_004444 Homo sapiens EPH receptor B4 (EPHB4), mRNA. ORF Sequence $859.56
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004444.4, 55774978
Length 4369 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens EPH receptor B4 (EPHB4), mRNA.
Product ephrin type-B receptor 4 precursor
Comment

Summary: Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene binds to ephrin-B2 and plays an essential role in vascular development. [provided by RefSeq, Jul 2008].

RefSeq NP_004435.3
CDS 492..3455
Misc Feature(1)480..482
Misc Feature(2)576..1079
Misc Feature(3)order(576..578,618..629,633..641,645..647,651..653,
Misc Feature(4)1281..1388
Misc Feature(5)1461..1778
Misc Feature(6)order(1461..1463,1683..1685,1728..1730)
Misc Feature(7)order(1740..1745,1752..1757)
Misc Feature(8)1791..2069
Misc Feature(9)order(1791..1793,1986..1988,2031..2033)
Misc Feature(10)order(2034..2039,2043..2048)
Misc Feature(11)2109..2171
Misc Feature(12)2319..3125
Misc Feature(13)2334..3113
Misc Feature(14)order(2352..2366,2376..2378,2424..2426,2430..2432,
Misc Feature(15)order(2352..2360,2364..2366,2376..2378,2424..2426,
Misc Feature(16)order(2709..2711,2721..2723,2826..2840,2865..2867,
Misc Feature(17)2760..2846
Misc Feature(18)3201..3398
Misc Feature(19)3210..3410
Misc Feature(20)3222..3224
Misc Feature(21)order(3261..3263,3360..3362)
Misc Feature(22)3417..3419
Misc Feature(23)3444..3452
Misc Feature(24)3450..3452
Exon (1)1..543
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (2)544..614
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (3)615..902
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (4)903..1299
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (5)1300..1455
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (6)1456..1788
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (7)1789..1913
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (8)1914..2079
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (9)2080..2182
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (10)2183..2247
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (11)2248..2361
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (12)2362..2609
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (13)2610..2825
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (14)2826..2975
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (15)2976..3169
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (16)3170..3325
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Exon (17)3326..4351
Gene:EPHB4
Gene Synonym:HTK; MYK1; TYRO11
Translation MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK ILASVQHMKSQAKPGTPGGTGGPAPQY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(206)-dbSNP:
complement(206)-t, gdbSNP:189006064
complement(229)-g, adbSNP:183661477
complement(368)-g, cdbSNP:2571606
complement(417)-g, adbSNP:116409758
complement(531)-t, cdbSNP:139513482
complement(564)-dbSNP:
complement(564)-g, adbSNP:144551580
complement(624)-dbSNP:
complement(624)-g, cdbSNP:149287966
complement(653)-g, adbSNP:3735694
complement(691)-g, adbSNP:34653459
complement(692)-t, cdbSNP:138656609
complement(712)-t, cdbSNP:61735971
complement(741)-t, cdbSNP:201465765
complement(758)-t, cdbSNP:150582750
complement(771)-t, cdbSNP:34745261
complement(795)-g, adbSNP:141985925
complement(808)-g, adbSNP:199871056
complement(828)-t, cdbSNP:55866373
complement(845)-g, adbSNP:200452203
complement(846)-t, cdbSNP:201416777
complement(857)-t, cdbSNP:146092347
complement(863)-t, cdbSNP:202126100
complement(869)-g, adbSNP:145080354
complement(871)-g, adbSNP:142856240
complement(910)-dbSNP:
complement(910)-g, adbSNP:200549250
complement(956)-g, adbSNP:201197431
complement(976)-t, cdbSNP:17854760
complement(980)-t, cdbSNP:61130921
complement(1037)-g, adbSNP:56173078
complement(1055)-t, cdbSNP:201682575
complement(1083)-t, g, cdbSNP:112443300
complement(1114)-g, adbSNP:111749768
complement(1115)-c, adbSNP:200156491
complement(1151)-g, adbSNP:200580904
complement(1173)-t, cdbSNP:146902369
complement(1179)-t, cdbSNP:142009811
complement(1182)-g, adbSNP:147563837
complement(1194)-g, adbSNP:200701924
complement(1293)-c, adbSNP:201816920
complement(1329)-dbSNP:
complement(1329)-g, adbSNP:144988774
complement(1339)-t, cdbSNP:201531252
complement(1391)-g, adbSNP:143853125
complement(1399)-t, cdbSNP:61735974
complement(1406)-g, adbSNP:139571805
complement(1409)-g, adbSNP:151161414
complement(1473)-dbSNP:
complement(1473)-t, gdbSNP:199701655
complement(1478)-g, adbSNP:200232840
complement(1508)-c, adbSNP:55867842
complement(1543)-t, cdbSNP:77303848
complement(1558)-g, cdbSNP:192640017
complement(1569)-g, adbSNP:201467689
complement(1570)-t, cdbSNP:202006098
complement(1603)-g, adbSNP:55720981
complement(1634)-g, adbSNP:2289058
complement(1635)-t, cdbSNP:114926839
complement(1722)-t, cdbSNP:144185458
complement(1742)-t, cdbSNP:202220624
complement(1745)-t, cdbSNP:55843039
complement(1749)-t, cdbSNP:61735975
complement(1783)-g, cdbSNP:74779801
complement(1805)-dbSNP:
complement(1805)-t, cdbSNP:144173
complement(1819)-g, adbSNP:183759430
complement(1822)-c, adbSNP:146064780
complement(1823)-c, adbSNP:142736543
complement(1847)-g, cdbSNP:150291524
complement(1848)-t, cdbSNP:138234752
complement(1849)-g, adbSNP:150425369
complement(1863)-g, adbSNP:141544967
complement(1871)-g, adbSNP:148350653
complement(1875)-t, cdbSNP:146674844
complement(1879)-t, gdbSNP:7457245
complement(1902)-c, adbSNP:3891495
complement(1905)-g, adbSNP:149712104
complement(1934)-dbSNP:
complement(1934)-g, adbSNP:142650086
complement(1965)-t, cdbSNP:147737164
complement(1975)-t, cdbSNP:200691435
complement(2017)-g, cdbSNP:146937374
complement(2045)-g, adbSNP:148818692
complement(2084)-dbSNP:
complement(2084)-g, adbSNP:55682161
complement(2089)-c, adbSNP:149690566
complement(2095)-t, cdbSNP:139594739
complement(2116)-g, adbSNP:201096509
complement(2123)-t, cdbSNP:201252094
complement(2172)-g, cdbSNP:199707528
complement(2215)-dbSNP:
complement(2215)-g, adbSNP:60537976
complement(2219)-g, cdbSNP:36050247
complement(2234)-g, adbSNP:116240595
complement(2243)-g, adbSNP:314359
complement(2244)-g, adbSNP:78081360
complement(2290)-dbSNP:
complement(2290)-t, cdbSNP:139432679
complement(2381)-dbSNP:
complement(2381)-t, cdbSNP:2230585
complement(2447)-g, adbSNP:183383429
complement(2449)-t, adbSNP:199997663
complement(2458)-t, cdbSNP:201283096
complement(2463)-g, adbSNP:142798266
complement(2515)-t, cdbSNP:148505212
complement(2524)-t, cdbSNP:55692440
complement(2534)-g, adbSNP:200520910
complement(2571)-t, cdbSNP:58976385
complement(2579)-t, cdbSNP:144756820
complement(2588)-g, adbSNP:149377356
complement(2616)-dbSNP:
complement(2616)-t, cdbSNP:202157491
complement(2642)-g, adbSNP:112613465
complement(2669)-t, cdbSNP:199591006
complement(2699)-g, adbSNP:201350870
complement(2743)-t, adbSNP:200376692
complement(2782)-c, adbSNP:138760334
complement(2801)-g, adbSNP:147302485
complement(2813)-g, adbSNP:143966632
complement(2819..2820)-, adbSNP:35809853
complement(2888)-dbSNP:
complement(2888)-g, adbSNP:201140601
complement(2921)-t, cdbSNP:199910843
complement(2948)-t, cdbSNP:201929093
complement(2951)-t, cdbSNP:138574211
complement(2965)-t, cdbSNP:147110749
complement(3006)-dbSNP:
complement(3006)-g, adbSNP:140135838
complement(3080)-g, cdbSNP:148193109
complement(3108)-t, cdbSNP:201842419
complement(3135)-t, cdbSNP:34918225
complement(3149)-g, adbSNP:149061889
complement(3157)-t, cdbSNP:146445434
complement(3161)-c, adbSNP:35638378
complement(3168)-t, cdbSNP:140332222
complement(3169)-c, adbSNP:146768192
complement(3189)-dbSNP:
complement(3189)-g, cdbSNP:200795996
complement(3195)-g, adbSNP:200953030
complement(3200)-t, cdbSNP:149744160
complement(3212)-t, cdbSNP:139596649
complement(3269)-c, adbSNP:1056997
complement(3271)-t, cdbSNP:199674277
complement(3275)-g, adbSNP:200688295
complement(3355)-dbSNP:
complement(3355)-g, adbSNP:139196073
complement(3440)-c, adbSNP:112803997
complement(3445)-g, adbSNP:140842916
complement(3446)-t, cdbSNP:56086910
complement(3471)-g, adbSNP:192294324
complement(3486)-t, cdbSNP:199872533
complement(3498)-, adbSNP:67087640
complement(3508)-c, adbSNP:1056999
complement(3593..3594)-, tcdbSNP:150843773
complement(3594)-, tcdbSNP:113576131
complement(3635)-g, adbSNP:201276061
complement(3769)-t, cdbSNP:188396001
complement(3775)-t, cdbSNP:112333978
complement(3807)-g, adbSNP:146906933
complement(3816)-c, adbSNP:184730214
complement(3884)-g, cdbSNP:56326327
complement(3896)-g, adbSNP:144057522
complement(4022)-g, adbSNP:76600840
complement(4083)-t, cdbSNP:3735693
complement(4102)-g, adbSNP:79415738
complement(4119)-g, cdbSNP:138315905
complement(4197)-t, cdbSNP:192741390
complement(4241)-t, cdbSNP:143643119
complement(4244)-t, cdbSNP:187750973
complement(4261)-t, cdbSNP:182382342
complement(4291)-t, adbSNP:1802594
Gene SymbolEPHB4
Gene SynonymHTK; MYK1; TYRO11
Chromosome7
Locus Map7q22
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004444 Homo sapiens EPH receptor B4 (EPHB4), mRNA. Full Length $1529.15
ORF Sequence $859.56
Title EphB4 is overexpressed in gliomas and promotes the growth of glioma cells .
Author Chen,T., Liu,X., Yi,S., Zhang,J., Ge,J. and Liu,Z.
Journal Tumour Biol. 34 (1), 379-385 (2013)
Title Critical role for the receptor tyrosine kinase EPHB4 in esophageal cancers .
Author Hasina,R., Mollberg,N., Kawada,I., Mutreja,K., Kanade,G., Yala,S., Surati,M., Liu,R., Li,X., Zhou,Y., Ferguson,B.D., Nallasura,V., Cohen,K.S., Hyjek,E., Mueller,J., Kanteti,R., El Hashani,E., Kane,D., Shimada,Y., Lingen,M.W., Husain,A.N., Posner,M.C., Waxman,I., Villaflor,V.M., Ferguson,M.K., Varticovski,L., Vokes,E.E., Gill,P. and Salgia,R.
Journal Cancer Res. 73 (1), 184-194 (2013)
Title EphB4 is overexpressed in papillary thyroid carcinoma and promotes the migration of papillary thyroid cancer cells .
Author Xuqing,W., Lei,C., Zhengfa,M., Shengchun,D., Xin,F., Jianguo,Q. and Jianxin,Z.
Journal Tumour Biol. 33 (5), 1419-1427 (2012)
Title EphB4 gene polymorphism and protein expression in non-small-cell lung cancer .
Author Zheng,M.F., Ji,Y., Wu,X.B., Ye,S.G. and Chen,J.Y.
Journal Mol Med Rep 6 (2), 405-408 (2012)
Title Expression of EphrinB2 and EphB4 in glioma tissues correlated to the progression of glioma and the prognosis of glioblastoma patients .
Author Tu,Y., He,S., Fu,J., Li,G., Xu,R., Lu,H. and Deng,J.
Journal Clin Transl Oncol 14 (3), 214-220 (2012)
Title The Eph family receptors and ligands .
Author Zhou,R.
Journal Pharmacol. Ther. 77 (3), 151-181 (1998)
Title The ephrins and Eph receptors in neural development .
Author Flanagan,J.G. and Vanderhaeghen,P.
Journal Annu. Rev. Neurosci. 21, 309-345 (1998)
Title Expression of the receptor protein tyrosine kinase myk-1/htk in normal and malignant mammary epithelium .
Author Berclaz,G., Andres,A.C., Albrecht,D., Dreher,E., Ziemiecki,A., Gusterson,B.A. and Crompton,M.R.
Journal Biochem. Biophys. Res. Commun. 226 (3), 869-875 (1996)
Title Cloning and characterization of HTK, a novel transmembrane tyrosine kinase of the EPH subfamily .
Author Bennett,B.D., Wang,Z., Kuang,W.J., Wang,A., Groopman,J.E., Goeddel,D.V. and Scadden,D.T.
Journal J. Biol. Chem. 269 (19), 14211-14218 (1994)
Title Expression of two novel eph-related receptor protein tyrosine kinases in mammary gland development and carcinogenesis .
Author Andres,A.C., Reid,H.H., Zurcher,G., Blaschke,R.J., Albrecht,D. and Ziemiecki,A.
Journal Oncogene 9 (5), 1461-1467 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878