• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19131 Homo sapiens polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19131C Homo sapiens polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004482.3, 153266877
Length 1902 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3), mRNA.
Product polypeptide N-acetylgalactosaminyltransferase 3
Comment

Summary: This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities. [provided by RefSeq, Jul 2008].

RefSeq NP_004473.2
CDS 388..2289
Misc Feature(1)367..369
Misc Feature(2)445..498
Misc Feature(3)445..498
Misc Feature(4)937..1266
Misc Feature(5)949..1866
Misc Feature(6)order(961..969,973..975,1060..1062,1147..1149,1156..1158,
Misc Feature(7)order(1216..1218,1222..1224,1630..1632)
Misc Feature(8)1453..1641
Misc Feature(9)1900..2268
Misc Feature(10)1906..2274
Misc Feature(11)order(1942..1944,1978..1980,1984..1986,2008..2013,
Misc Feature(12)order(2011..2019,2146..2154,2260..2268)
Exon (1)1..279
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (2)280..902
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (3)903..1075
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (4)1076..1225
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (5)1226..1460
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (6)1461..1578
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (7)1579..1779
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (8)1780..1911
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (9)1912..2013
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (10)2014..2166
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Exon (11)2167..3267
Gene:GALNT3
Gene Synonym:GalNAc-T3; HFTC; HHS
Translation MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKN KMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNA PGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKLDEYV KQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTA VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP TFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRL QCKNFTWYLNNIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGG NQYFEYSAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNP FLKMCLSANGEHPSLVSCNPSDPLQKWILSQND
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(93)-dbSNP:
complement(93)-t, adbSNP:111425435
complement(225)-g, cdbSNP:113347272
complement(260)-g, adbSNP:367963105
complement(317)-dbSNP:
complement(317)-t, cdbSNP:372734049
complement(357)-t, cdbSNP:370646500
complement(403)-g, adbSNP:376963628
complement(438)-g, adbSNP:149612790
complement(475)-g, adbSNP:181288197
complement(504)-t, adbSNP:150417505
complement(519)-t, cdbSNP:149809222
complement(552)-g, cdbSNP:140452696
complement(576)-t, cdbSNP:188814778
complement(578)-t, adbSNP:372745199
complement(591)-t, cdbSNP:201112446
complement(596)-g, adbSNP:200433365
complement(614)-g, adbSNP:112139686
complement(625)-t, adbSNP:200044494
complement(649)-t, gdbSNP:374042912
complement(656)-g, adbSNP:367589956
complement(665)-c, adbSNP:376146715
complement(680)-c, adbSNP:143136193
complement(724)-g, adbSNP:371697905
complement(725)-t, cdbSNP:200762567
complement(752)-t, cdbSNP:374241607
complement(760)-t, cdbSNP:200595607
complement(766)-c, adbSNP:139145525
complement(794)-t, cdbSNP:114745771
complement(813)-t, cdbSNP:200856137
complement(846)-g, adbSNP:371366884
complement(847)-g, cdbSNP:368590625
complement(869)-t, adbSNP:370325883
871+c, tdbSNP:137853086
complement(880)-t, cdbSNP:147779149
complement(891)-g, adbSNP:183709224
complement(893)-t, cdbSNP:377319905
complement(894)-t, cdbSNP:150682922
complement(925)-dbSNP:
complement(925)-g, adbSNP:377392356
complement(931)-g, adbSNP:148553477
complement(936)-g, adbSNP:144776270
complement(947)-g, adbSNP:373080566
complement(977)-g, adbSNP:201078015
complement(981)-g, cdbSNP:145021953
complement(986)-g, adbSNP:138645426
complement(1056)-t, cdbSNP:13423840
complement(1062)-g, adbSNP:367815601
complement(1072)-t, cdbSNP:4641949
complement(1079)-dbSNP:
complement(1079)-t, cdbSNP:376216552
complement(1105)-g, cdbSNP:146978168
complement(1152)-t, cdbSNP:73972163
complement(1160)-c, adbSNP:45498901
complement(1161)-t, gdbSNP:144214001
complement(1169)-t, cdbSNP:111875321
complement(1180)-g, cdbSNP:373564887
complement(1186)-c, adbSNP:114933655
1202+a, cdbSNP:137853090
complement(1203)-t, cdbSNP:140732631
complement(1218)-t, adbSNP:139397826
complement(1252)-dbSNP:
complement(1252)-g, adbSNP:201022045
complement(1283)-g, adbSNP:150889917
complement(1284)-c, adbSNP:75931918
complement(1288)-t, cdbSNP:143647583
complement(1312)-t, cdbSNP:149544089
complement(1318)-g, cdbSNP:371852814
complement(1326)-t, cdbSNP:141293620
complement(1329)-g, adbSNP:370969667
1353+g, tdbSNP:137853088
complement(1369)-g, adbSNP:138728996
1463+dbSNP:
1463+a, cdbSNP:137853091
complement(1466)-g, adbSNP:377053222
complement(1499)-t, cdbSNP:200518001
complement(1581)-dbSNP:
complement(1581)-t, cdbSNP:150937941
complement(1614)-t, adbSNP:149017052
complement(1624)-t, cdbSNP:143799357
complement(1640)-t, cdbSNP:143396063
complement(1706)-t, gdbSNP:199930810
complement(1735)-t, cdbSNP:146096050
complement(1756)-t, cdbSNP:377389049
complement(1771)-t, cdbSNP:373760885
1828+dbSNP:
1828+c, tdbSNP:137853089
complement(1868)-g, adbSNP:374205386
complement(1911)-g, adbSNP:144331248
complement(1921)-dbSNP:
complement(1921)-t, cdbSNP:374713815
complement(1928)-t, cdbSNP:200031817
complement(1984)-g, adbSNP:371714077
complement(1992)-t, adbSNP:200815957
complement(2045)-dbSNP:
complement(2045)-t, cdbSNP:201855584
complement(2076)-g, adbSNP:370190472
complement(2078)-g, adbSNP:377579661
complement(2086)-t, cdbSNP:376449936
complement(2092)-t, cdbSNP:146521644
complement(2095)-g, adbSNP:373524164
2107+g, tdbSNP:267606841
complement(2130)-t, cdbSNP:370027205
complement(2144)-t, cdbSNP:148063331
2161+c, tdbSNP:137853087
complement(2199)-dbSNP:
complement(2199)-t, cdbSNP:142817583
complement(2208)-t, cdbSNP:377605951
complement(2214)-g, adbSNP:142136047
complement(2215)-t, cdbSNP:375108704
complement(2244)-g, adbSNP:150299191
complement(2257)-g, adbSNP:201456142
complement(2290)-c, adbSNP:146884408
complement(2293)-g, adbSNP:112704936
complement(2475)-g, adbSNP:183674066
complement(2561)-t, cdbSNP:115677211
complement(2570)-t, adbSNP:13429321
complement(2607..2608)-, tadbSNP:140333197
complement(2630)-t, adbSNP:77911197
complement(2794)-g, adbSNP:80130906
complement(2804)-t, cdbSNP:144354033
complement(2821)-t, cdbSNP:373178990
2856+a, gdbSNP:1048222
complement(2976)-c, adbSNP:191523871
complement(2999)-t, adbSNP:11538293
complement(3063)-g, adbSNP:11538294
complement(3072)-t, cdbSNP:115493554
complement(3159)-t, adbSNP:189290881
complement(3181)-c, adbSNP:150039125
complement(3223..3224)-, adbSNP:144647329
Gene SymbolGALNT3
Gene SynonymGalNAc-T3; HFTC; HHS
Chromosome2
Locus Map2q24-q31
Title Neuronal expression of GalNAc transferase is sufficient to prevent the age-related neurodegenerative phenotype of complex ganglioside-deficient mice .
Author Yao D, McGonigal R, Barrie JA, Cappell J, Cunningham ME, Meehan GR, Fewou SN, Edgar JM, Rowan E, Ohmi Y, Furukawa K, Furukawa K, Brophy
Journal J. Neurosci. 34 (3), 880-891 (2014)
Title Polypeptide N-acetylgalactosaminyl transferase 3 independently predicts high-grade tumours and poor prognosis in patients with renal cell carcinomas .
Author Kitada S, Yamada S, Kuma A, Ouchi S, Tasaki T, Nabeshima A, Noguchi H, Wang KY, Shimajiri S, Nakano R, Izumi H, Kohno K, Matsumoto T and Sasaguri Y.
Journal Br. J. Cancer 109 (2), 472-481 (2013)
Title Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture .
Author Estrada K, Styrkarsdottir U, Evangelou E, Hsu YH, Duncan EL, Ntzani EE, Oei L, Albagha OM, Amin N, Kemp JP, Koller DL, Li G, Liu CT, Minster RL, Moayyeri A, Vandenput L, Willner D, Xiao SM, Yerges-Armstrong LM, Zheng HF, Alonso N, Eriksson J, Kammerer CM, Kaptoge SK, Leo PJ, Thorleifsson G, Wilson SG, Wilson JF, Aalto V, Alen M, Aragaki AK, Aspelund T, Center JR, Dailiana Z, Duggan DJ, Garcia M, Garcia-Giralt N, Giroux S, Hallmans G, Hocking LJ, Husted LB, Jameson KA, Khusainova R, Kim GS, Kooperberg C, Koromila T, Kruk M, Laaksonen M, Lacroix AZ, Lee SH, Leung PC, Lewis JR, Masi L, Mencej-Bedrac S, Nguyen TV, Nogues X, Patel MS, Prezelj J, Rose LM, Scollen S, Siggeirsdottir K, Smith AV, Svensson O, Trompet S, Trummer O, van Schoor NM, Woo J, Zhu K, Balcells S, Brandi ML, Buckley BM, Cheng S, Christiansen C, Cooper C, Dedoussis G, Ford I, Frost M, Goltzman D, Gonzalez-Macias J, Kahonen M, Karlsson M, Khusnutdinova E, Koh JM, Kollia P, Langdahl BL, Leslie WD, Lips P, Ljunggren O, Lorenc RS, Marc J, Mellstrom D, Obermayer-Pietsch B, Olmos JM, Pettersson-Kymmer U, Reid DM, Riancho JA, Ridker PM, Rousseau F, Slagboom PE, Tang NL, Urreizti R, Van Hul W, Viikari J, Zarrabeitia MT, Aulchenko YS, Castano-Betancourt M, Grundberg E, Herrera L, Ingvarsson T, Johannsdottir H, Kwan T, Li R, Luben R, Medina-Gomez C, Palsson ST, Reppe S, Rotter JI, Sigurdsson G, van Meurs JB, Verlaan D, Williams FM, Wood AR, Zhou Y, Gautvik KM, Pastinen T, Raychaudhuri S, Cauley JA, Chasman DI, Clark GR, Cummings SR, Danoy P, Dennison EM, Eastell R, Eisman JA, Gudnason V, Hofman A, Jackson RD, Jones G, Jukema JW, Khaw KT, Lehtimaki T, Liu Y, Lorentzon M, McCloskey E, Mitchell BD, Nandakumar K, Nicholson GC, Oostra BA, Peacock M, Pols HA, Prince RL, Raitakari O, Reid IR, Robbins J, Sambrook PN, Sham PC, Shuldiner AR, Tylavsky FA, van Duijn CM, Wareham NJ, Cupples LA, Econs MJ, Evans DM, Harris TB, Kung AW, Psaty BM, Reeve J, Spector TD, Streeten EA, Zillikens MC, Thorsteinsdottir U, Ohlsson C, Karasik D, Richards JB, Brown MA, Stefansson K, Uitterlinden AG, Ralston SH, Ioannidis JP, Kiel DP and Rivadeneira F.
Journal Nat. Genet. 44 (5), 491-501 (2012)
Title Overexpression of GalNAc-transferase GalNAc-T3 promotes pancreatic cancer cell growth .
Author Taniuchi K, Cerny RL, Tanouchi A, Kohno K, Kotani N, Honke K, Saibara T and Hollingsworth MA.
Journal Oncogene 30 (49), 4843-4854 (2011)
Title Genome-wide association study using extreme truncate selection identifies novel genes affecting bone mineral density and fracture risk .
Author Duncan EL, Danoy P, Kemp JP, Leo PJ, McCloskey E, Nicholson GC, Eastell R, Prince RL, Eisman JA, Jones G, Sambrook PN, Reid IR, Dennison EM, Wark J, Richards JB, Uitterlinden AG, Spector TD, Esapa C, Cox RD, Brown SD, Thakker RV, Addison KA, Bradbury LA, Center JR, Cooper C, Cremin C, Estrada K, Felsenberg D, Gluer CC, Hadler J, Henry MJ, Hofman A, Kotowicz MA, Makovey J, Nguyen SC, Nguyen TV, Pasco JA, Pryce K, Reid DM, Rivadeneira F, Roux C, Stefansson K, Styrkarsdottir U, Thorleifsson G, Tichawangana R, Evans DM and Brown MA.
Journal PLoS Genet. 7 (4), E1001372 (2011)
Title Expression of polypeptide GalNAc-transferases in stratified epithelia and squamous cell carcinomas: immunohistological evaluation using monoclonal antibodies to three members of the GalNAc-transferase family .
Author Mandel U, Hassan H, Therkildsen MH, Rygaard J, Jakobsen MH, Juhl BR, Dabelsteen E and Clausen H.
Journal Glycobiology 9 (1), 43-52 (1999)
Title Genomic organization and chromosomal localization of three members of the UDP-N-acetylgalactosamine: polypeptide N-acetylgalactosaminyltransferase family .
Author Bennett EP, Weghuis DO, Merkx G, van Kessel AG, Eiberg H and Clausen H.
Journal Glycobiology 8 (6), 547-555 (1998)
Title Localization of three human polypeptide GalNAc-transferases in HeLa cells suggests initiation of O-linked glycosylation throughout the Golgi apparatus .
Author Rottger S, White J, Wandall HH, Olivo JC, Stark A, Bennett EP, Whitehouse C, Berger EG, Clausen H and Nilsson T.
Journal J. Cell. Sci. 111 (PT 1), 45-60 (1998)
Title Substrate specificities of three members of the human UDP-N-acetyl-alpha-D-galactosamine:Polypeptide N-acetylgalactosaminyltransferase family, GalNAc-T1, -T2, and -T3 .
Author Wandall HH, Hassan H, Mirgorodskaya E, Kristensen AK, Roepstorff P, Bennett EP, Nielsen PA, Hollingsworth MA, Burchell J, Taylor-Papadimitriou J and Clausen H.
Journal J. Biol. Chem. 272 (38), 23503-23514 (1997)
Title cDNA cloning and expression of a novel human UDP-N-acetyl-alpha-D-galactosamine. Polypeptide N-acetylgalactosaminyltransferase, GalNAc-t3 .
Author Bennett EP, Hassan H and Clausen H.
Journal J. Biol. Chem. 271 (29), 17006-17012 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.