• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens forkhead box A3 (FOXA3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25423 Homo sapiens forkhead box A3 (FOXA3), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu25423C Homo sapiens forkhead box A3 (FOXA3), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004497.2, 24497505
Length 1053 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens forkhead box A3 (FOXA3), mRNA.
Product hepatocyte nuclear factor 3-gamma
Comment

Summary: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008].

RefSeq NP_004488.2
CDS 198..1250
Misc Feature(1)186..188
Misc Feature(2)546..779
Misc Feature(3)546..779
Misc Feature(4)order(654..659,684..686,693..698,756..758)
Exon (1)1..266
Gene:FOXA3
Gene Synonym:FKHH3; HNF3G; TCF3G
Exon (2)267..1989
Gene:FOXA3
Gene Synonym:FKHH3; HNF3G; TCF3G
Translation MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
63+dbSNP:
63+g, tdbSNP:60133195
153+a, cdbSNP:199879108
186+c, tdbSNP:11667582
278+dbSNP:
278+a, gdbSNP:143578664
279+a, gdbSNP:201137445
287+a, gdbSNP:376849431
387+c, tdbSNP:150825228
394+a, cdbSNP:369922937
414+a, cdbSNP:373073243
420+a, gdbSNP:374973423
447+a, cdbSNP:377068089
463+a, gdbSNP:150013684
514+c, tdbSNP:368584465
525+c, tdbSNP:145277260
528+c, tdbSNP:142143651
529+a, gdbSNP:371892021
532+c, gdbSNP:202014979
542+c, tdbSNP:144459600
554+a, gdbSNP:147847262
596+a, gdbSNP:141782286
638+c, tdbSNP:374769245
661+a, gdbSNP:200377130
680+c, gdbSNP:12977291
684+a, cdbSNP:12976619
689+c, tdbSNP:199787706
690+a, gdbSNP:141446079
713+c, tdbSNP:16980091
734+a, gdbSNP:373998257
758+a, gdbSNP:372030164
768+g, tdbSNP:12984947
774+c, tdbSNP:12983057
822+c, tdbSNP:371065526
908+c, tdbSNP:200743469
940+a, cdbSNP:201747924
948+c, tdbSNP:371687599
977+c, tdbSNP:28666870
1023+c, gdbSNP:140760356
1042+a, gdbSNP:150110884
1070+a, gdbSNP:368851781
1080+a, gdbSNP:372848865
1083+a, gdbSNP:138611202
1084+c, tdbSNP:200491833
1090+a, gdbSNP:199535549
1112+c, tdbSNP:199745348
1136+c, gdbSNP:150205438
1140+c, tdbSNP:374864416
complement(1151)-t, gdbSNP:3810327
1160+c, tdbSNP:146135785
1178+c, tdbSNP:374364567
1179+a, gdbSNP:377404065
1241+c, tdbSNP:369283603
1243+c, tdbSNP:201509811
1246+c, tdbSNP:201921681
1277+a, gdbSNP:201192060
1285+a, gdbSNP:183121927
1296+c, tdbSNP:369305438
1329..1330+, tdbSNP:374555969
1388+c, gdbSNP:368712646
1414+c, tdbSNP:57358251
1471+a, gdbSNP:371215982
complement(1479)-t, cdbSNP:149386619
1552+c, tdbSNP:16980100
1777+a, gdbSNP:190181599
1976+a, gdbSNP:181069377
Gene SymbolFOXA3
Gene SynonymFKHH3; HNF3G; TCF3G
Chromosome19
Locus Map19q13.2-q13.4
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004497 Homo sapiens forkhead box A3 (FOXA3), mRNA. On-demand $219.00 7-9
Title Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity .
Author Chen G, Korfhagen TR, Karp CL, Impey S, Xu Y, Randell SH, Kitzmiller J, Maeda Y, Haitchi HM, Sridharan A, Senft AP and Whitsett JA.
Journal Am. J. Respir. Crit. Care Med. 189 (3), 301-313 (2014)
Title The winged helix transcription factor Foxa3 regulates adipocyte differentiation and depot-selective fat tissue expansion .
Author Xu L, Panel V, Ma X, Du C, Hugendubler L, Gavrilova O, Liu A, McLaughlin T, Kaestner KH and Mueller E.
Journal Mol. Cell. Biol. 33 (17), 3392-3399 (2013)
Title [Caloric restriction suppresses endothelial cells senescence via down-regulation of NOX4 induced by HNF3gamma] .
Author Liu Q, Li H, Chen HH and Wang J.
Journal Yi Chuan 34 (5), 573-583 (2012)
Title Genetic predictors of interindividual variability in hepatic CYP3A4 expression .
Author Lamba V, Panetta JC, Strom S and Schuetz EG.
Journal J. Pharmacol. Exp. Ther. 332 (3), 1088-1099 (2010)
Title Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq .
Author Motallebipour M, Ameur A, Reddy Bysani MS, Patra K, Wallerman O, Mangion J, Barker MA, McKernan KJ, Komorowski J and Wadelius C.
Journal Genome Biol. 10 (11), R129 (2009)
Title The role of HNF1alpha, HNF3gamma, and cyclic AMP in glucose-6-phosphatase gene activation .
Author Lin B, Morris DW and Chou JY.
Journal Biochemistry 36 (46), 14096-14106 (1997)
Title Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4 .
Author Mincheva A, Lichter P, Schutz G and Kaestner KH.
Journal Genomics 39 (3), 417-419 (1997)
Title Analysis of hepatocyte nuclear factor-3 beta protein domains required for transcriptional activation and nuclear targeting .
Author Qian X and Costa RH.
Journal Nucleic Acids Res. 23 (7), 1184-1191 (1995)
Title Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5 .
Author Clark KL, Halay ED, Lai E and Burley SK.
Journal Nature 364 (6436), 412-420 (1993)
Title Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells .
Author Hromas R, Moore J, Johnston T, Socha C and Klemsz M.
Journal Blood 81 (11), 2854-2859 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.