• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens forkhead box A3 (FOXA3), mRNA.


RefSeq Accession Definition Services Price Order
NM_004497 Homo sapiens forkhead box A3 (FOXA3), mRNA. ORF Sequence $305.37
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004497.2, 24497505
Length 2046 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens forkhead box A3 (FOXA3), mRNA.
Product hepatocyte nuclear factor 3-gamma
Comment

Summary: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008].

RefSeq NP_004488.2
CDS 198..1250
Misc Feature(1)186..188
Misc Feature(2)546..779
Misc Feature(3)546..779
Misc Feature(4)order(654..659,684..686,693..698,756..758)
Exon (1)1..266
Gene:FOXA3
Gene Synonym:FKHH3; HNF3G; TCF3G
Exon (2)267..1989
Gene:FOXA3
Gene Synonym:FKHH3; HNF3G; TCF3G
Translation MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
63+dbSNP:
63+g, tdbSNP:60133195
153+a, cdbSNP:199879108
186+c, tdbSNP:11667582
278+dbSNP:
278+a, gdbSNP:143578664
279+a, gdbSNP:201137445
387+c, tdbSNP:150825228
442+g, tdbSNP:139291348
463+a, gdbSNP:150013684
525+c, tdbSNP:145277260
528+c, tdbSNP:142143651
532+c, gdbSNP:202014979
542+c, tdbSNP:144459600
554+a, gdbSNP:147847262
596+a, gdbSNP:141782286
661+a, gdbSNP:200377130
680+c, gdbSNP:12977291
684+a, cdbSNP:12976619
689+c, tdbSNP:199787706
690+a, gdbSNP:141446079
713+c, tdbSNP:16980091
743+a, cdbSNP:147987720
768+g, tdbSNP:12984947
774+c, tdbSNP:12983057
908+c, tdbSNP:200743469
940+a, cdbSNP:201747924
977+c, tdbSNP:28666870
1023+c, gdbSNP:140760356
1042+a, gdbSNP:150110884
1083+a, gdbSNP:138611202
1084+c, tdbSNP:200491833
1090+a, gdbSNP:199535549
1112+c, tdbSNP:199745348
1136+c, gdbSNP:150205438
1151+g, tdbSNP:3810327
1160+c, tdbSNP:146135785
1243+c, tdbSNP:201509811
1246+c, tdbSNP:201921681
1277+a, gdbSNP:201192060
1285+a, gdbSNP:183121927
1414+c, tdbSNP:57358251
1479+c, tdbSNP:149386619
1552+c, tdbSNP:16980100
1777+a, gdbSNP:190181599
1976+a, gdbSNP:181069377
Gene SymbolFOXA3
Gene SynonymFKHH3; HNF3G; TCF3G
Chromosome19
Locus Map19q13.2-q13.4
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004497 Homo sapiens forkhead box A3 (FOXA3), mRNA. Full Length $593.34
ORF Sequence $305.37
Title [Caloric restriction suppresses endothelial cells senescence via down-regulation of NOX4 induced by HNF3gamma] .
Author Liu,Q., Li,H., Chen,H.H. and Wang,J.
Journal Yi Chuan 34 (5), 573-583 (2012)
Title Genetic predictors of interindividual variability in hepatic CYP3A4 expression .
Author Lamba,V., Panetta,J.C., Strom,S. and Schuetz,E.G.
Journal J. Pharmacol. Exp. Ther. 332 (3), 1088-1099 (2010)
Title Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq .
Author Motallebipour,M., Ameur,A., Reddy Bysani,M.S., Patra,K., Wallerman,O., Mangion,J., Barker,M.A., McKernan,K.J., Komorowski,J. and Wadelius,C.
Journal Genome Biol. 10 (11), R129 (2009)
Title Foxp2 inhibits Nkx2.1-mediated transcription of SP-C via interactions with the Nkx2.1 homeodomain .
Author Zhou,B., Zhong,Q., Minoo,P., Li,C., Ann,D.K., Frenkel,B., Morrisey,E.E., Crandall,E.D. and Borok,Z.
Journal Am. J. Respir. Cell Mol. Biol. 38 (6), 750-758 (2008)
Title Differentiation of insulin-producing cells from human neural progenitor cells .
Author Hori,Y., Gu,X., Xie,X. and Kim,S.K.
Journal PLoS Med. 2 (4), E103 (2005)
Title The role of HNF1alpha, HNF3gamma, and cyclic AMP in glucose-6-phosphatase gene activation .
Author Lin,B., Morris,D.W. and Chou,J.Y.
Journal Biochemistry 36 (46), 14096-14106 (1997)
Title Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4 .
Author Mincheva,A., Lichter,P., Schutz,G. and Kaestner,K.H.
Journal Genomics 39 (3), 417-419 (1997)
Title Analysis of hepatocyte nuclear factor-3 beta protein domains required for transcriptional activation and nuclear targeting .
Author Qian,X. and Costa,R.H.
Journal Nucleic Acids Res. 23 (7), 1184-1191 (1995)
Title Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5 .
Author Clark,K.L., Halay,E.D., Lai,E. and Burley,S.K.
Journal Nature 364 (6436), 412-420 (1993)
Title Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells .
Author Hromas,R., Moore,J., Johnston,T., Socha,C. and Klemsz,M.
Journal Blood 81 (11), 2854-2859 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878