• THAT   AND
  • THAT   AND


Homo sapiens forkhead box A3 (FOXA3), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004497 Homo sapiens forkhead box A3 (FOXA3), mRNA. Full Lenth $593.34
ORF Sequence $305.37


RefSeq Version NM_004497.2, 24497505
Length 2046 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens forkhead box A3 (FOXA3), mRNA.
Product hepatocyte nuclear factor 3-gamma
Comment

Summary: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq].

RefSeq NP_004488.2
CDS 198..1250
Exon (1)1..266
Exon (2)1..266
Exon (3)267..1989
Translation MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
63+g, tdbSNP:60133195
186+c, tdbSNP:11667582
680+c, gdbSNP:12977291
684+a, cdbSNP:12976619
713+c, tdbSNP:16980091
768+g, tdbSNP:12984947
774+c, tdbSNP:12983057
977+c, tdbSNP:28666870
complement(1151)-t, gdbSNP:3810327
1285+a, gdbSNP:76501767
1287+c, gdbSNP:75866797
1414+c, tdbSNP:57358251
1552+c, tdbSNP:16980100
1955+g, tdbSNP:75246363
1960+a, tdbSNP:75290923
Gene SymbolFOXA3
Gene SynonymFKHH3; HNF3G; MGC10179; TCF3G
Chromosome19
Locus Map19q13.2-q13.4
All Transcripts NM_004497
Title Genetic predictors of interindividual variability in hepatic CYP3A4 expression .
Author Lamba,V., Panetta,J.C., Strom,S. and Schuetz,E.G.
Journal J. Pharmacol. Exp. Ther. 332 (3), 1088-1099 (2010)
Title Differential binding and co-binding pattern of FOXA1 and FOXA3 and their relation to H3K4me3 in HepG2 cells revealed by ChIP-seq .
Author Motallebipour,M., Ameur,A., Reddy Bysani,M.S., Patra,K., Wallerman,O., Mangion,J., Barker,M.A., McKernan,K.J., Komorowski,J. and Wadelius,C.
Journal Genome Biol. 10 (11), R129 (2009)
Title Foxp2 inhibits Nkx2.1-mediated transcription of SP-C via interactions with the Nkx2.1 homeodomain .
Author Zhou,B., Zhong,Q., Minoo,P., Li,C., Ann,D.K., Frenkel,B., Morrisey,E.E., Crandall,E.D. and Borok,Z.
Journal Am. J. Respir. Cell Mol. Biol. 38 (6), 750-758 (2008)
Title A hepatocyte nuclear factor-3 site in the fibrinogen beta promoter is important for interleukin 6-induced expression, and its activity is influenced by the adjacent -148C/T polymorphism .
Author Verschuur,M., de Jong,M., Felida,L., de Maat,M.P. and Vos,H.L.
Journal J. Biol. Chem. 280 (17), 16763-16771 (2005)
Title Differentiation of insulin-producing cells from human neural progenitor cells .
Author Hori,Y., Gu,X., Xie,X. and Kim,S.K.
Journal PLoS Med. 2 (4), E103 (2005)
Title The role of HNF1alpha, HNF3gamma, and cyclic AMP in glucose-6-phosphatase gene activation .
Author Lin,B., Morris,D.W. and Chou,J.Y.
Journal Biochemistry 36 (46), 14096-14106 (1997)
Title Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4 .
Author Mincheva,A., Lichter,P., Schutz,G. and Kaestner,K.H.
Journal Genomics 39 (3), 417-419 (1997)
Title Analysis of hepatocyte nuclear factor-3 beta protein domains required for transcriptional activation and nuclear targeting .
Author Qian,X. and Costa,R.H.
Journal Nucleic Acids Res. 23 (7), 1184-1191 (1995)
Title Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5 .
Author Clark,K.L., Halay,E.D., Lai,E. and Burley,S.K.
Journal Nature 364 (6436), 412-420 (1993)
Title Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells .
Author Hromas,R., Moore,J., Johnston,T., Socha,C. and Klemsz,M.
Journal Blood 81 (11), 2854-2859 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878