• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu54595 Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu54595C Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004536.2, 119393877
Length 4212 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 1, mRNA.
Product baculoviral IAP repeat-containing protein 1 isoform 1
Comment

Summary: This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This copy of the gene is full length; additional copies with truncations and internal deletions are also present in this region of chromosome 5q13. It is thought that this gene is a modifier of spinal muscular atrophy caused by mutations in a neighboring gene, SMN1. The protein encoded by this gene contains regions of homology to two baculovirus inhibitor of apoptosis proteins, and it is able to suppress apoptosis induced by various signals. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_004527.2
CDS 719..4930
Misc Feature(1)689..691
Misc Feature(2)896..1099
Misc Feature(3)896..1099
Misc Feature(4)899..1105
Misc Feature(5)order(983..985,998..1000,1004..1006,1025..1033,1037..1039,
Misc Feature(6)order(1007..1009,1016..1018,1067..1069,1088..1090)
Misc Feature(7)1193..1399
Misc Feature(8)1196..1405
Misc Feature(9)order(1283..1285,1298..1300,1304..1306,1325..1333,
Misc Feature(10)order(1307..1309,1316..1318,1367..1369,1388..1390)
Misc Feature(11)1550..1753
Misc Feature(12)1553..1759
Misc Feature(13)order(1637..1639,1652..1654,1658..1660,1679..1687,
Misc Feature(14)order(1661..1663,1670..1672,1721..1723,1742..1744)
Misc Feature(15)2105..2518
Misc Feature(16)2108..2569
Misc Feature(17)<4229..>4855
Misc Feature(18)order(4265..4267,4274..4276,4280..4282,4289..4291,
Exon (1)1..500
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (2)501..589
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (3)590..715
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (4)716..1286
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (5)1287..1386
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (6)1387..1468
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (7)1469..1520
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (8)1521..1640
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (9)1641..1740
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (10)1741..1822
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (11)1823..1880
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (12)1881..3992
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (13)3993..4160
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (14)4161..4313
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (15)4314..4400
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (16)4401..4565
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Exon (17)4566..6551
Gene:NAIP
Gene Synonym:BIRC1; NLRB1; psiNAIP
Translation MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSE AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQ QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE SLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNFHHMEKLLIQISA EYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAVPFVA SLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNM PNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKER HPQSKYLTILQKWILPFSPIIQK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
308+dbSNP:
308+a, gdbSNP:371577427
complement(664)-dbSNP:
complement(664)-g, adbSNP:112342150
666+c, tdbSNP:200966956
680+c, gdbSNP:201829840
687+a, gdbSNP:200031007
complement(745)-g, adbSNP:369240054
755..756+, cdbSNP:35140058
complement(767)-t, gdbSNP:139139439
complement(785)-g, adbSNP:372493351
complement(799)-c, adbSNP:200175804
complement(818)-g, adbSNP:141020129
complement(822)-g, adbSNP:370514410
complement(854)-g, adbSNP:372715693
complement(855)-t, cdbSNP:141634501
complement(858)-g, cdbSNP:189765950
complement(901)-t, gdbSNP:201454876
complement(907)-c, adbSNP:115486998
complement(934)-t, cdbSNP:144684936
complement(944)-g, adbSNP:181247511
complement(945)-t, cdbSNP:147313514
complement(974)-c, adbSNP:74601090
complement(984)-g, cdbSNP:367842667
complement(999)-t, cdbSNP:147757754
complement(1006)-t, cdbSNP:374870047
complement(1039)-g, adbSNP:142807071
complement(1040)-t, cdbSNP:202204990
complement(1046)-t, adbSNP:374597236
complement(1087)-g, adbSNP:377203882
complement(1126)-g, cdbSNP:147988011
complement(1190)-g, cdbSNP:200427852
complement(1199)-t, cdbSNP:61757629
complement(1210)-t, cdbSNP:28409706
complement(1250)-g, adbSNP:373901116
complement(1299)-dbSNP:
complement(1299)-g, adbSNP:201023314
complement(1300)-t, cdbSNP:192546915
complement(1305)-t, cdbSNP:376332840
complement(1326)-t, cdbSNP:145345185
complement(1351)-g, adbSNP:372547585
complement(1354)-g, adbSNP:373924503
complement(1381)-g, adbSNP:147075777
complement(3421)-t, cdbSNP:144305867
complement(4136)-dbSNP:
complement(4136)-t, cdbSNP:76228942
complement(5216..5217)-dbSNP:
complement(5216..5217)-, tdbSNP:201481029
Gene SymbolNAIP
Gene SynonymBIRC1; NLRB1; psiNAIP
Chromosome5
Locus Map5q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_022892 Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 2, mRNA. On-demand $1699.00 25
NM_004536 Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant 1, mRNA. On-demand $1699.00 25
XM_006714626 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X5, mRNA. On-demand $1699.00 25
XM_006714627 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X6, mRNA. On-demand $1699.00 25
XM_006714628 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X7, mRNA. On-demand $1699.00 25
XM_006714629 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X8, mRNA. On-demand $1699.00 25
XM_005248523 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X3, mRNA. On-demand $1699.00 25
XM_006714630 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X9, mRNA. On-demand $279.00 12-14
XM_005248524 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X4, mRNA. On-demand $279.00 12-14
XM_006726219 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X9, mRNA. On-demand $1699.00 25
XM_006726220 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X10, mRNA. On-demand $1699.00 25
XM_006726221 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X11, mRNA. On-demand $1699.00 25
XM_006726222 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X12, mRNA. On-demand $1699.00 25
XM_005276800 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X5, mRNA. On-demand $1699.00 25
XM_005276801 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X6, mRNA. On-demand $279.00 12-14
XM_005276802 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X7, mRNA. On-demand $279.00 12-14
XM_006725453 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X1, mRNA. On-demand $1699.00 25
XM_006725454 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006725455 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X3, mRNA. On-demand $1699.00 25
XM_006725456 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X4, mRNA. On-demand $1699.00 25
XM_006725457 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X5, mRNA. On-demand $1699.00 25
XM_006725458 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X6, mRNA. On-demand $279.00 12-14
XM_006725459 PREDICTED: Homo sapiens NLR family, apoptosis inhibitory protein (NAIP), transcript variant X7, mRNA. On-demand $279.00 12-14
Title Interaction with the Yes-associated protein (YAP) allows TEAD1 to positively regulate NAIP expression .
Author Landin Malt A, Georges A, Silber J, Zider A and Flagiello D.
Journal FEBS Lett. 587 (19), 3216-3223 (2013)
Title Human NAIP and mouse NAIP1 recognize bacterial type III secretion needle protein for inflammasome activation .
Author Yang J, Zhao Y, Shi J and Shao F.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (35), 14408-14413 (2013)
Title Formation and structure of a NAIP5-NLRC4 inflammasome induced by direct interactions with conserved N- and C-terminal regions of flagellin .
Author Halff EF, Diebolder CA, Versteeg M, Schouten A, Brondijk TH and Huizinga EG.
Journal J. Biol. Chem. 287 (46), 38460-38472 (2012)
Title Correlation of SMN2, NAIP, p44, H4F5 and Occludin genes copy number with spinal muscular atrophy phenotype in Tunisian patients .
Author Amara A, Adala L, Ben Charfeddine I, Mamai O, Mili A, Lazreg TB, H'mida D, Amri F, Salem N, Boughammura L, Saad A and Gribaa M.
Journal Eur. J. Paediatr. Neurol. 16 (2), 167-174 (2012)
Title Population variation in NAIP functional copy number confers increased cell death upon Legionella pneumophila infection .
Author Boniotto M, Tailleux L, Lomma M, Gicquel B, Buchrieser C, Garcia S and Quintana-Murci L.
Journal Hum. Immunol. 73 (2), 196-200 (2012)
Title Identification of two distinct transcripts for the neuronal apoptosis inhibitory protein gene .
Author Yamamoto K, Sakai H, Hadano S, Gondo Y and Ikeda JE.
Journal Biochem. Biophys. Res. Commun. 264 (3), 998-1006 (1999)
Title A single nucleotide difference that alters splicing patterns distinguishes the SMA gene SMN1 from the copy gene SMN2 .
Author Monani UR, Lorson CL, Parsons DW, Prior TW, Androphy EJ, Burghes AH and McPherson JD.
Journal Hum. Mol. Genet. 8 (7), 1177-1183 (1999)
Title Suppression of apoptosis in mammalian cells by NAIP and a related family of IAP genes .
Author Liston P, Roy N, Tamai K, Lefebvre C, Baird S, Cherton-Horvat G, Farahani R, McLean M, Ikeda JE, MacKenzie A and Korneluk RG.
Journal Nature 379 (6563), 349-353 (1996)
Title The gene for neuronal apoptosis inhibitory protein is partially deleted in individuals with spinal muscular atrophy .
Author Roy N, Mahadevan MS, McLean M, Shutler G, Yaraghi Z, Farahani R, Baird S, Besner-Johnston A, Lefebvre C and Kang X.
Journal Cell 80 (1), 167-178 (1995)
Title A provisional transcript map of the spinal muscular atrophy (SMA) critical region .
Author van der Steege G, Draaijers TG, Grootscholten PM, Osinga J, Anzevino R, Velona I, Den Dunnen JT, Scheffer H, Brahe C and van Ommen GJ.
Journal Eur. J. Hum. Genet. 3 (2), 87-95 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.