• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens POU class 4 homeobox 2 (POU4F2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004575 Homo sapiens POU class 4 homeobox 2 (POU4F2), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_004575.2, 110347454
Length 3141 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens POU class 4 homeobox 2 (POU4F2), mRNA.
Product POU domain, class 4, transcription factor 2
Comment

Summary: The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting in accelerated tumor growth. [provided by RefSeq, Sep 2011].

RefSeq NP_004566.2
CDS 249..1478
Misc Feature(1)210..212
Misc Feature(2)576..605
Misc Feature(3)576..605
Misc Feature(4)996..1229
Misc Feature(5)1284..1460
Misc Feature(6)order(1284..1298,1302..1304,1353..1355,1371..1373,
Misc Feature(7)order(1290..1292,1299..1301,1419..1421,1428..1433,
Exon (1)1..536
Gene:POU4F2
Gene Synonym:Brn-3b; BRN3.2; BRN3B
Exon (2)537..3141
Gene:POU4F2
Gene Synonym:Brn-3b; BRN3.2; BRN3B
Translation MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGG GGGGGGGGRSSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIV SQSKSHHHHPPHHSPFKPDATYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHH HHQPHQALEGELLEHLSPGLALGAMAGPDGAVVSTPAHAPHMATMNPMHQAALSMAHAHG LPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTIC RFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSL EAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+dbSNP:
21+g, tdbSNP:143373833
97+a, gdbSNP:370191425
112+g, tdbSNP:372544942
155+a, gdbSNP:35733768
194+c, tdbSNP:369199465
200+c, tdbSNP:369625548
209+c, gdbSNP:373501732
217+c, tdbSNP:376572394
243+a, gdbSNP:202046663
275+a, gdbSNP:200843721
293+g, tdbSNP:146671454
294+a, cdbSNP:62327967
296+a, cdbSNP:369358968
319+c, tdbSNP:199899657
338+c, tdbSNP:373682041
344+c, tdbSNP:140261687
367+c, tdbSNP:13152799
372+c, tdbSNP:184591480
414..415+, ggcdbSNP:72269802
416+c, tdbSNP:189899086
448..449+, cggdbSNP:5862765
482+c, gdbSNP:199600550
508+c, tdbSNP:145352817
513+a, cdbSNP:148020860
532+c, tdbSNP:141725106
544+dbSNP:
544+c, tdbSNP:201496393
625+a, gdbSNP:372609971
640+c, tdbSNP:150150229
665+a, cdbSNP:147517729
666+a, gdbSNP:74417037
695+a, gdbSNP:143938073
707+c, tdbSNP:139883264
752+a, gdbSNP:143876216
764+c, tdbSNP:369535679
768+a, cdbSNP:376900695
798+c, tdbSNP:144284868
809+a, gdbSNP:376581460
828+a, gdbSNP:371559221
851+c, tdbSNP:200464919
862+c, tdbSNP:373979098
866+a, gdbSNP:202030431
878+c, tdbSNP:376822201
893+a, c, gdbSNP:200695260
899+g, tdbSNP:373088055
915+a, gdbSNP:377219455
943+c, tdbSNP:376992021
962+a, gdbSNP:148751103
965+a, cdbSNP:373594627
991+g, tdbSNP:373360428
1005+a, gdbSNP:3827593
1059+a, cdbSNP:200579530
1065+c, gdbSNP:142395313
1073+a, cdbSNP:151303999
1095+c, tdbSNP:76129457
1105+a, tdbSNP:373485818
1107+a, cdbSNP:376482978
1114+c, gdbSNP:144507526
1119+a, gdbSNP:369337694
1122+a, gdbSNP:372535541
1123+g, tdbSNP:200312228
1126+c, tdbSNP:371120198
1172+c, gdbSNP:3827594
1190+g, tdbSNP:61733420
1209+a, gdbSNP:145278389
1238+c, tdbSNP:144940288
1242+a, gdbSNP:267600031
1246+a, cdbSNP:199979947
1275+a, gdbSNP:377411656
1277+g, tdbSNP:370767940
1278+a, gdbSNP:375025437
1298+g, tdbSNP:371952832
1306+c, gdbSNP:200705430
1308+a, gdbSNP:374901217
1310+a, gdbSNP:367653245
1313+a, gdbSNP:61733419
1328+c, gdbSNP:143117935
1334+c, tdbSNP:148247830
1341+g, tdbSNP:180935169
1344+a, gdbSNP:142851123
1349+c, gdbSNP:372860552
1358+c, tdbSNP:199813288
1374+a, gdbSNP:147007829
1376+c, tdbSNP:200415873
1385+a, gdbSNP:369917575
1409+a, cdbSNP:138240408
1432+a, gdbSNP:113095745
1453+g, tdbSNP:201841354
1466+c, tdbSNP:370757448
1469+a, c, tdbSNP:143812023
1489+g, tdbSNP:3810843
1503+a, gdbSNP:376016201
1508+g, tdbSNP:370553185
1613+a, gdbSNP:368127169
1663+c, tdbSNP:372340520
1690+a, tdbSNP:369146164
1840+a, gdbSNP:376565147
1850+, cdbSNP:201294453
1989+g, tdbSNP:72956271
2013+a, gdbSNP:76180708
2091+a, gdbSNP:186245328
2216+a, gdbSNP:139670347
2280+c, tdbSNP:114364181
2423+c, tdbSNP:7669891
2423+c, tdbSNP:386423488
2494+c, tdbSNP:372851210
2526..2527+, ac, acacacdbSNP:71592457
2526+c, tdbSNP:200297474
2527..2528+, acdbSNP:375277243
2542..2543+, cadbSNP:72274820
2552..2553+, ac, acac, acacacacdbSNP:60422325
2590+a, gdbSNP:6825713
2595+a, gdbSNP:111877076
2665+c, tdbSNP:191340422
2777+a, gdbSNP:183140735
2841+g, tdbSNP:369169254
2846+a, cdbSNP:186059151
2919+c, tdbSNP:144585453
2978+a, gdbSNP:74571172
3092+c, tdbSNP:190835038
Gene SymbolPOU4F2
Gene SynonymBrn-3b; BRN3.2; BRN3B
Chromosome4
Locus Map4q31.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004575 Homo sapiens POU class 4 homeobox 2 (POU4F2), mRNA. On-demand TBD TBD
Title Diagnosis of bladder cancer recurrence based on urinary levels of EOMES, HOXA9, POU4F2, TWIST1, VIM, and ZNF154 hypermethylation .
Author Reinert T, Borre M, Christiansen A, Hermann GG, Orntoft TF and Dyrskjot L.
Journal PLoS ONE 7 (10), E46297 (2012)
Title Hsp-27 induction requires POU4F2/Brn-3b TF in doxorubicin-treated breast cancer cells, whereas phosphorylation alters its cellular localisation following drug treatment .
Author Fujita R, Ounzain S, Wang AC, Heads RJ and Budhram-Mahadeo VS.
Journal Cell Stress Chaperones 16 (4), 427-439 (2011)
Title A comprehensive negative regulatory program controlled by Brn3b to ensure ganglion cell specification from multipotential retinal precursors .
Author Qiu F, Jiang H and Xiang M.
Journal J. Neurosci. 28 (13), 3392-3403 (2008)
Title Proliferation-associated Brn-3b transcription factor can activate cyclin D1 expression in neuroblastoma and breast cancer cells .
Author Budhram-Mahadeo VS, Irshad S, Bowen S, Lee SA, Samady L, Tonini GP and Latchman DS.
Journal Oncogene 27 (1), 145-154 (2008)
Title Post-transcriptional regulation of the Brn-3b transcription factor in differentiating neuroblastoma cells .
Author Calissano M, Diss JK and Latchman DS.
Journal FEBS Lett. 581 (13), 2490-2496 (2007)
Title Inhibition of neuronal process outgrowth and neuronal specific gene activation by the Brn-3b transcription factor .
Author Smith MD, Dawson SJ and Latchman DS.
Journal J. Biol. Chem. 272 (2), 1382-1388 (1997)
Title The Brn-3 family of POU-domain factors: primary structure, binding specificity, and expression in subsets of retinal ganglion cells and somatosensory neurons .
Author Xiang M, Zhou L, Macke JP, Yoshioka T, Hendry SH, Eddy RL, Shows TB and Nathans J.
Journal J. Neurosci. 15 (7 PT 1), 4762-4785 (1995)
Title Differential expression of four members of the POU family of proteins in activated and phorbol 12-myristate 13-acetate-treated Jurkat T cells .
Author Bhargava AK, Li Z and Weissman SM.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (21), 10260-10264 (1993)
Title Brn-3b: a POU domain gene expressed in a subset of retinal ganglion cells .
Author Xiang M, Zhou L, Peng YW, Eddy RL, Shows TB and Nathans J.
Journal Neuron 11 (4), 689-701 (1993)
Title The human Brn-3b POU transcription factor shows only limited homology to the Brn-3a/RDC-1 factor outside the conserved POU domain .
Author Ring CJ and Latchman DS.
Journal Nucleic Acids Res. 21 (12), 2946 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.