• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_004591 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004591.2, 194239686
Length 851 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.
Product C-C motif chemokine 20 isoform 1 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from D17012.1, D86955.1, U77035.1 and U64197.1. On Jul 12, 2008 this sequence version replaced gi:4759075.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_004582.1
CDS 71..361
Misc Feature(1)41..43
Misc Feature(2)41..43
Misc Feature(3)158..340
Misc Feature(4)161..172
Misc Feature(5)order(164..178,182..205,239..244,308..340)
Misc Feature(6)order(170..172,176..178,215..217,221..223,242..244,
Misc Feature(7)order(170..172,176..178,227..229,239..244,260..262,
Misc Feature(8)order(170..172,260..262,287..289)
Misc Feature(9)order(170..178,182..205)
Misc Feature(10)order(176..178,215..217,221..223,257..259,263..265,
Misc Feature(11)order(182..190,197..205,275..277,281..283)
Misc Feature(12)order(221..223,248..250,302..304,308..310,317..322,
Misc Feature(13)239..244
Misc Feature(14)order(269..271,275..277)
Exon (1)1..146
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (2)147..261
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (3)262..339
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (4)340..842
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Translation MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+a, gdbSNP:200671152
59+c, gdbSNP:75547135
137+a, gdbSNP:138641525
176+dbSNP:
176+c, tdbSNP:144260473
209+a, gdbSNP:1049617
217+c, tdbSNP:75543153
234+a, gdbSNP:191551340
247+a, cdbSNP:62190019
252+a, gdbSNP:148327362
292+dbSNP:
292+c, tdbSNP:150823624
404+dbSNP:
404+a, gdbSNP:150460518
708+g, tdbSNP:189256502
713..714+, adbSNP:200141595
713+a, tdbSNP:192889020
714+a, tdbSNP:185328021
729+a, gdbSNP:188367228
774+a, gdbSNP:181269900
829+a, cdbSNP:116536511
Gene SymbolCCL20
Gene SynonymCKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Chromosome2
Locus Map2q36.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001130046 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 2, mRNA. Full Length $245.92
ORF Sequence $159.00
NM_004591 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA. Full Length $246.79
ORF Sequence $159.00
Title Macrophage inflammatory protein-3 alpha (MIP-3a) is a novel serum prognostic marker in patients with colorectal cancer .
Author Iwata,T., Tanaka,K., Inoue,Y., Toiyama,Y., Hiro,J., Fujikawa,H., Okugawa,Y., Uchida,K., Mohri,Y. and Kusunoki,M.
Journal J Surg Oncol 107 (2), 160-166 (2013)
Title ORMDL3 is an inducible lung epithelial gene regulating metalloproteases, chemokines, OAS, and ATF6 .
Author Miller,M., Tam,A.B., Cho,J.Y., Doherty,T.A., Pham,A., Khorram,N., Rosenthal,P., Mueller,J.L., Hoffman,H.M., Suzukawa,M., Niwa,M. and Broide,D.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (41), 16648-16653 (2012)
Title Antimicrobial responses of primary gingival cells to Porphyromonas gingivalis .
Author Dommisch,H., Reinartz,M., Backhaus,T., Deschner,J., Chung,W. and Jepsen,S.
Journal J. Clin. Periodontol. 39 (10), 913-922 (2012)
Title The serine protease plasmin triggers expression of the CC-chemokine ligand 20 in dendritic cells via Akt/NF-kappaB-dependent pathways .
Author Li,X., Syrovets,T. and Simmet,T.
Journal J. Biomed. Biotechnol. 2012, 186710 (2012)
Title Human papillomavirus type 8 interferes with a novel C/EBPbeta-mediated mechanism of keratinocyte CCL20 chemokine expression and Langerhans cell migration .
Author Sperling,T., Oldak,M., Walch-Ruckheim,B., Wickenhauser,C., Doorbar,J., Pfister,H., Malejczyk,M., Majewski,S., Keates,A.C. and Smola,S.
Journal PLoS Pathog. 8 (7), E1002833 (2012)
Title Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC .
Author Baba,M., Imai,T., Nishimura,M., Kakizaki,M., Takagi,S., Hieshima,K., Nomiyama,H. and Yoshie,O.
Journal J. Biol. Chem. 272 (23), 14893-14898 (1997)
Title Cloning and characterization of exodus, a novel beta-chemokine .
Author Hromas,R., Gray,P.W., Chantry,D., Godiska,R., Krathwohl,M., Fife,K., Bell,G.I., Takeda,J., Aronica,S., Gordon,M., Cooper,S., Broxmeyer,H.E. and Klemsz,M.J.
Journal Blood 89 (9), 3315-3322 (1997)
Title Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2 .
Author Hieshima,K., Imai,T., Opdenakker,G., Van Damme,J., Kusuda,J., Tei,H., Sakaki,Y., Takatsuki,K., Miura,R., Yoshie,O. and Nomiyama,H.
Journal J. Biol. Chem. 272 (9), 5846-5853 (1997)
Title Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta .
Author Rossi,D.L., Vicari,A.P., Franz-Bacon,K., McClanahan,T.K. and Zlotnik,A.
Journal J. Immunol. 158 (3), 1033-1036 (1997)
Title The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression .
Author Matoba,R., Okubo,K., Hori,N., Fukushima,A. and Matsubara,K.
Journal Gene 146 (2), 199-207 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878