• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004591 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $299.00 14

*Business Day

Related Services

RefSeq Version NM_004591.2, 194239686
Length 851 bp
Structure linear
Update Date 02-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.
Product C-C motif chemokine 20 isoform 1 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from D17012.1, D86955.1, U77035.1 and U64197.1. On Jul 12, 2008 this sequence version replaced gi:4759075.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_004582.1
CDS 71..361
Misc Feature(1)41..43
Misc Feature(2)41..43
Misc Feature(3)158..340
Misc Feature(4)161..172
Misc Feature(5)order(164..178,182..205,239..244,308..340)
Misc Feature(6)order(170..172,176..178,215..217,221..223,242..244,
Misc Feature(7)order(170..172,176..178,227..229,239..244,260..262,
Misc Feature(8)order(170..172,260..262,287..289)
Misc Feature(9)order(170..178,182..205)
Misc Feature(10)order(176..178,215..217,221..223,257..259,263..265,
Misc Feature(11)order(182..190,197..205,275..277,281..283)
Misc Feature(12)order(221..223,248..250,302..304,308..310,317..322,
Misc Feature(13)239..244
Misc Feature(14)order(269..271,275..277)
Exon (1)1..146
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (2)147..261
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (3)262..339
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Exon (4)340..842
Gene:CCL20
Gene Synonym:CKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Translation MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
52+a, gdbSNP:200671152
59+c, gdbSNP:75547135
67+a, gdbSNP:376118694
137+a, gdbSNP:138641525
176+dbSNP:
176+c, tdbSNP:144260473
209+a, gdbSNP:1049617
217+c, tdbSNP:75543153
234+a, gdbSNP:191551340
247+a, cdbSNP:62190019
252+a, gdbSNP:148327362
257+a, gdbSNP:374526713
292+dbSNP:
292+c, tdbSNP:150823624
323+a, gdbSNP:368201222
404+dbSNP:
404+a, gdbSNP:150460518
663..664+, gdbSNP:370669597
708+g, tdbSNP:189256502
713..714+, adbSNP:200141595
713+a, tdbSNP:192889020
714+a, tdbSNP:185328021
729+a, gdbSNP:188367228
774+a, gdbSNP:181269900
829+a, cdbSNP:116536511
829+g, tdbSNP:386437946
Gene SymbolCCL20
Gene SynonymCKb4; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Chromosome2
Locus Map2q36.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004591 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA. On-demand $299.00 14
NM_001130046 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 2, mRNA. In-stock $248.00 $199.00 10
Title CCR6/CCL20 chemokine expression profile in distinct colorectal malignancies .
Author Frick VO, Rubie C, Kolsch K, Wagner M, Ghadjar P, Graeber S and Glanemann M.
Journal Scand. J. Immunol. 78 (3), 298-305 (2013)
Title Genetic variants associated with disordered eating .
Author Wade TD, Gordon S, Medland S, Bulik CM, Heath AC, Montgomery GW and Martin NG.
Journal Int J Eat Disord 46 (6), 594-608 (2013)
Title CCL20 induces migration and proliferation on breast epithelial cells .
Author Marsigliante S, Vetrugno C and Muscella A.
Journal J. Cell. Physiol. 228 (9), 1873-1883 (2013)
Title Recruitment of CCR6-expressing Th17 cells by CCL20 secreted from plasmin-stimulated macrophages .
Author Li Q, Laumonnier Y, Syrovets T and Simmet T.
Journal Acta Biochim. Biophys. Sin. (Shanghai) 45 (7), 593-600 (2013)
Title Chemokine (C-C motif) ligand 20, a potential biomarker for Graves' disease, is regulated by osteopontin .
Author Li X, Qi Y, Ma X, Huang F, Guo H, Jiang X, Hong J, Lin D, Cui B, Ning G, Xu L and Wang S.
Journal PLoS ONE 8 (5), E64277 (2013)
Title Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC .
Author Baba M, Imai T, Nishimura M, Kakizaki M, Takagi S, Hieshima K, Nomiyama H and Yoshie O.
Journal J. Biol. Chem. 272 (23), 14893-14898 (1997)
Title Cloning and characterization of exodus, a novel beta-chemokine .
Author Hromas R, Gray PW, Chantry D, Godiska R, Krathwohl M, Fife K, Bell GI, Takeda J, Aronica S, Gordon M, Cooper S, Broxmeyer HE and Klemsz MJ.
Journal Blood 89 (9), 3315-3322 (1997)
Title Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2 .
Author Hieshima K, Imai T, Opdenakker G, Van Damme J, Kusuda J, Tei H, Sakaki Y, Takatsuki K, Miura R, Yoshie O and Nomiyama H.
Journal J. Biol. Chem. 272 (9), 5846-5853 (1997)
Title Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta .
Author Rossi DL, Vicari AP, Franz-Bacon K, McClanahan TK and Zlotnik A.
Journal J. Immunol. 158 (3), 1033-1036 (1997)
Title The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression .
Author Matoba R, Okubo K, Hori N, Fukushima A and Matsubara K.
Journal Gene 146 (2), 199-207 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.