• THAT   AND
  • THAT   AND


Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004591 Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA. Full Lenth $246.79
ORF Sequence $159.00


RefSeq Version NM_004591.2, 194239686
Length 851 bp
Structure linear
Update Date 24-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA.
Product C-C motif chemokine 20 isoform 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from D17012.1, D86955.1, U77035.1 and U64197.1. On Jul 12, 2008 this sequence version replaced gi:4759075.

RefSeq NP_004582.1
CDS 71..361
Exon (1)1..146
Exon (2)1..146
Exon (3)147..261
Exon (4)262..339
Exon (5)340..842
Translation MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
59+c, gdbSNP:75547135
209+a, gdbSNP:1049617
217+c, tdbSNP:75543153
247+a, cdbSNP:62190019
714+a, tdbSNP:79800152
829+a, cdbSNP:116536511
Gene SymbolCCL20
Gene SynonymCKb4; LARC; MIP-3a; MIP3A; SCYA20; ST38
Chromosome2
Locus Map2q33-q37
All Transcripts NM_004591 , NM_001130046
Title CCL20 and beta-defensin-2 induce arrest of human Th17 cells on inflamed endothelium in vitro under flow conditions .
Author Ghannam,S., Dejou,C., Pedretti,N., Giot,J.P., Dorgham,K., Boukhaddaoui,H., Deleuze,V., Bernard,F.X., Jorgensen,C., Yssel,H. and Pene,J.
Journal J. Immunol. 186 (3), 1411-1420 (2011)
Title Chemokine (C-C) motif ligand 20 is regulated by PGF(2alpha)-F-prostanoid receptor signalling in endometrial adenocarcinoma and promotes cell proliferation .
Author Wallace,A.E., Catalano,R.D., Anderson,R.A. and Jabbour,H.N.
Journal Mol. Cell. Endocrinol. 331 (1), 129-135 (2011)
Title CCL20 is overexpressed in Mycobacterium tuberculosis-infected monocytes and inhibits the production of reactive oxygen species (ROS) .
Author Rivero-Lezcano,O.M., Gonzalez-Cortes,C., Reyes-Ruvalcaba,D. and Diez-Tascon,C.
Journal Clin. Exp. Immunol. 162 (2), 289-297 (2010)
Title Response of corneal epithelial cells to Staphylococcus aureus .
Author Heimer,S.R., Yamada,A., Russell,H. and Gilmore,M.
Journal Virulence 1 (4), 223-235 (2010)
Title Chemokine-mediated distribution of dendritic cell subsets in renal cell carcinoma .
Author Middel,P., Brauneck,S., Meyer,W. and Radzun,H.J.
Journal BMC Cancer 10, 578 (2010)
Title Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC .
Author Baba,M., Imai,T., Nishimura,M., Kakizaki,M., Takagi,S., Hieshima,K., Nomiyama,H. and Yoshie,O.
Journal J. Biol. Chem. 272 (23), 14893-14898 (1997)
Title Cloning and characterization of exodus, a novel beta-chemokine .
Author Hromas,R., Gray,P.W., Chantry,D., Godiska,R., Krathwohl,M., Fife,K., Bell,G.I., Takeda,J., Aronica,S., Gordon,M., Cooper,S., Broxmeyer,H.E. and Klemsz,M.J.
Journal Blood 89 (9), 3315-3322 (1997)
Title Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2 .
Author Hieshima,K., Imai,T., Opdenakker,G., Van Damme,J., Kusuda,J., Tei,H., Sakaki,Y., Takatsuki,K., Miura,R., Yoshie,O. and Nomiyama,H.
Journal J. Biol. Chem. 272 (9), 5846-5853 (1997)
Title Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta .
Author Rossi,D.L., Vicari,A.P., Franz-Bacon,K., McClanahan,T.K. and Zlotnik,A.
Journal J. Immunol. 158 (3), 1033-1036 (1997)
Title The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression .
Author Matoba,R., Okubo,K., Hori,N., Fukushima,A. and Matsubara,K.
Journal Gene 146 (2), 199-207 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878