• THAT   AND
  • THAT   AND


Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004596 Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. Full Lenth $477.34
ORF Sequence $246.21


RefSeq Version NM_004596.4, 295317321
Length 1646 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.
Product U1 small nuclear ribonucleoprotein A
Comment

Summary: The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq].

RefSeq NP_004587.1
CDS 556..1404
Exon (1)1..628
Exon (2)1..628
Exon (3)629..801
Exon (4)802..981
Exon (5)982..1155
Exon (6)1156..1244
Exon (7)1245..1629
Translation MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
72+a, gdbSNP:16974492
86+a, tdbSNP:111978082
complement(288)-c, adbSNP:1455434
complement(418)-g, cdbSNP:1457141
427+c, tdbSNP:75531803
518+c, tdbSNP:11558816
734..735+, adbSNP:35864792
795+a, c, g, tdbSNP:2230694
951+c, tdbSNP:77290177
1008+c, tdbSNP:115500434
1215+c, tdbSNP:116493527
1436+c, tdbSNP:13108
1503+c, tdbSNP:1058852
1585+a, gdbSNP:4803366
1608+g, tdbSNP:117738851
Gene SymbolSNRPA
Gene SynonymMud1; U1-A; U1A
Chromosome19
Locus Map19q13.1
All Transcripts NM_004596
Title A bipartite U1 site represses U1A expression by synergizing with .
Author Guan,F., Caratozzolo,R.M., Goraczniak,R., Ho,E.S. and Gunderson,S.I.
Journal RNA 13 (12), 2129-2140 (2007)
Title Specific trans-acting proteins interact with auxiliary RNA polyadenylation elements in the COX-2 3'-UTR .
Author Hall-Pogar,T., Liang,S., Hague,L.K. and Lutz,C.S.
Journal RNA 13 (7), 1103-1115 (2007)
Title 13C NMR relaxation studies of RNA base and ribose nuclei reveal a complex pattern of motions in the RNA binding site for human U1A protein .
Author Shajani,Z. and Varani,G.
Journal J. Mol. Biol. 349 (4), 699-715 (2005)
Title Nucleolar proteome dynamics .
Author Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E., Lamond,A.I. and Mann,M.
Journal Nature 433 (7021), 77-83 (2005)
Title Identification of molecular contacts between the U1 A small nuclear ribonucleoprotein and U1 RNA .
Author Jessen,T.H., Oubridge,C., Teo,C.H., Pritchard,C. and Nagai,K.
Journal EMBO J. 10 (11), 3447-3456 (1991)
Title Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein .
Author Nelissen,R.L., Sillekens,P.T., Beijer,R.P., Geurts van Kessel,A.H. and van Venrooij,W.J.
Journal Gene 102 (2), 189-196 (1991)
Title RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins .
Author Hoffman,D.W., Query,C.C., Golden,B.L., White,S.W. and Keene,J.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (6), 2495-2499 (1991)
Title Quantitative determination that one of two potential RNA-binding domains of the A protein component of the U1 small nuclear ribonucleoprotein complex binds with high affinity to stem-loop II of U1 RNA .
Author Lutz-Freyermuth,C., Query,C.C. and Keene,J.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6393-6397 (1990)
Title Assignment of seven genes to distinct intervals on the midportion of human chromosome 19q surrounding the myotonic dystrophy gene region .
Author Schonk,D., van Dijk,P., Riegmann,P., Trapman,J., Holm,C., Willcocks,T.C., Sillekens,P., van Venrooij,W., Wimmer,E., Geurts van Kessel,A. et al.
Journal Cytogenet. Cell Genet. 54 (1-2), 15-19 (1990)
Title cDNA cloning of the human U1 snRNA-associated A protein: extensive homology between U1 and U2 snRNP-specific proteins .
Author Sillekens,P.T., Habets,W.J., Beijer,R.P. and van Venrooij,W.J.
Journal EMBO J. 6 (12), 3841-3848 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878