• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.


RefSeq Accession Definition Services Price Order
NM_004596 Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. ORF Sequence $246.21
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004596.4, 295317321
Length 1646 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.
Product U1 small nuclear ribonucleoprotein A
Comment

Summary: The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010].

RefSeq NP_004587.1
CDS 556..1404
Misc Feature(1)508..510
Misc Feature(2)<556..>861
Misc Feature(3)<556..>861
Misc Feature(4)559..561
Misc Feature(5)586..813
Misc Feature(6)order(592..594,715..717,721..723)
Misc Feature(7)733..735
Misc Feature(8)805..813
Misc Feature(9)946..948
Misc Feature(10)1183..1392
Misc Feature(11)order(1186..1188,1291..1293,1297..1299)
Misc Feature(12)1384..1392
Exon (1)1..628
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (2)629..801
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (3)802..981
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (4)982..1155
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (5)1156..1244
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (6)1245..1629
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Translation MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+a, gdbSNP:192585880
55+c, tdbSNP:185581242
72+a, gdbSNP:16974492
86+a, tdbSNP:111978082
288+a, cdbSNP:1455434
354+c, gdbSNP:182084754
418+c, gdbSNP:1457141
427+c, tdbSNP:75531803
516+a, cdbSNP:140145098
518+c, tdbSNP:11558816
524+c, tdbSNP:201840992
603+c, tdbSNP:138619399
641+dbSNP:
641+a, cdbSNP:11558817
648+c, tdbSNP:149329472
667+g, tdbSNP:144586987
707+c, tdbSNP:143591779
729+c, tdbSNP:202225969
733..734+, adbSNP:35864792
795+a, c, g, tdbSNP:2230694
822+dbSNP:
822+c, tdbSNP:138646758
853+a, tdbSNP:138535346
858+c, tdbSNP:201788574
928+a, gdbSNP:146345577
951+c, tdbSNP:77290177
1008+dbSNP:
1008+c, tdbSNP:115500434
1023+c, tdbSNP:201615676
1050+a, gdbSNP:146065356
1185+dbSNP:
1185+a, gdbSNP:140010893
1215+c, tdbSNP:116493527
1270+dbSNP:
1270+c, tdbSNP:144832566
1293+c, tdbSNP:148570725
1365+a, gdbSNP:142921812
1374+c, tdbSNP:142041325
1436+c, tdbSNP:13108
1442+a, gdbSNP:200257392
1503+c, tdbSNP:1058852
1585+a, gdbSNP:4803366
Gene SymbolSNRPA
Gene SynonymMud1; U1-A; U1A
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004596 Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. Full Length $477.34
ORF Sequence $246.21
Title U1A protein-stem loop 2 RNA recognition: prediction of structural differences from protein mutations .
Author Kormos,B.L., Pieniazek,S.N., Beveridge,D.L. and Baranger,A.M.
Journal Biopolymers 95 (9), 591-606 (2011)
Title The small nuclear ribonucleoprotein U1A interacts with NS5 from yellow fever virus .
Author Bronzoni,R.V., Madrid,M.C., Duarte,D.V., Pellegrini,V.O., Pacca,C.C., Carmo,A.C., Zanelli,C.F., Valentini,S.R., Santacruz-Perez,C., Barbosa,J.A., Lutz,C.S., Rahal,P. and Nogueira,M.L.
Journal Arch. Virol. 156 (6), 931-938 (2011)
Title Multistep kinetics of the U1A-SL2 RNA complex dissociation .
Author Anunciado,D., Dhar,A., Gruebele,M. and Baranger,A.M.
Journal J. Mol. Biol. 408 (5), 896-908 (2011)
Title Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins .
Author Ray,D., Kazan,H., Chan,E.T., Pena Castillo,L., Chaudhry,S., Talukder,S., Blencowe,B.J., Morris,Q. and Hughes,T.R.
Journal Nat. Biotechnol. 27 (7), 667-670 (2009)
Title Identification of molecular contacts between the U1 A small nuclear ribonucleoprotein and U1 RNA .
Author Jessen,T.H., Oubridge,C., Teo,C.H., Pritchard,C. and Nagai,K.
Journal EMBO J. 10 (11), 3447-3456 (1991)
Title Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein .
Author Nelissen,R.L., Sillekens,P.T., Beijer,R.P., Geurts van Kessel,A.H. and van Venrooij,W.J.
Journal Gene 102 (2), 189-196 (1991)
Title RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins .
Author Hoffman,D.W., Query,C.C., Golden,B.L., White,S.W. and Keene,J.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (6), 2495-2499 (1991)
Title Quantitative determination that one of two potential RNA-binding domains of the A protein component of the U1 small nuclear ribonucleoprotein complex binds with high affinity to stem-loop II of U1 RNA .
Author Lutz-Freyermuth,C., Query,C.C. and Keene,J.D.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6393-6397 (1990)
Title Assignment of seven genes to distinct intervals on the midportion of human chromosome 19q surrounding the myotonic dystrophy gene region .
Author Schonk,D., van Dijk,P., Riegmann,P., Trapman,J., Holm,C., Willcocks,T.C., Sillekens,P., van Venrooij,W., Wimmer,E., Geurts van Kessel,A. et al.
Journal Cytogenet. Cell Genet. 54 (1-2), 15-19 (1990)
Title cDNA cloning of the human U1 snRNA-associated A protein: extensive homology between U1 and U2 snRNP-specific proteins .
Author Sillekens,P.T., Habets,W.J., Beijer,R.P. and van Venrooij,W.J.
Journal EMBO J. 6 (12), 3841-3848 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878