• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu15951 Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu15951C Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004596.4, 295317321
Length 849 bp
Structure linear
Update Date 13-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA.
Product U1 small nuclear ribonucleoprotein A
Comment

Summary: The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010].

RefSeq NP_004587.1
CDS 556..1404
Misc Feature(1)508..510
Misc Feature(2)<556..>903
Misc Feature(3)<556..>903
Misc Feature(4)559..561
Misc Feature(5)574..840
Misc Feature(6)order(592..594,598..603,610..612,685..687,691..693,
Misc Feature(7)733..735
Misc Feature(8)946..948
Misc Feature(9)<1090..>1398
Misc Feature(10)1162..1401
Exon (1)1..628
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (2)629..801
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (3)802..981
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (4)982..1155
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (5)1156..1244
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Exon (6)1245..1629
Gene:SNRPA
Gene Synonym:Mud1; U1-A; U1A
Translation MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFK EVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPA TKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQI PPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV PGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
12+dbSNP:
12+a, gdbSNP:192585880
55+c, tdbSNP:185581242
72+a, gdbSNP:16974492
78+c, tdbSNP:376964186
86+a, tdbSNP:111978082
288+a, cdbSNP:386532583
complement(288)-c, adbSNP:1455434
315+a, gdbSNP:377665450
340+c, gdbSNP:370874353
354+c, gdbSNP:182084754
complement(418)-g, cdbSNP:1457141
427+c, tdbSNP:75531803
477+c, tdbSNP:368523279
516+a, cdbSNP:140145098
518+c, tdbSNP:11558816
524+c, tdbSNP:201840992
526+a, cdbSNP:370795053
576+c, tdbSNP:375774122
594+c, tdbSNP:377659020
603+c, tdbSNP:138619399
641+dbSNP:
641+a, cdbSNP:11558817
648+c, tdbSNP:149329472
657+c, tdbSNP:375457307
667+g, tdbSNP:144586987
694+c, tdbSNP:368973112
695+a, gdbSNP:373207469
707+c, tdbSNP:143591779
729+c, tdbSNP:202225969
734..735+, adbSNP:35864792
768+c, tdbSNP:376435515
795+a, c, g, tdbSNP:2230694
822+dbSNP:
822+c, tdbSNP:138646758
830+a, gdbSNP:374456745
853+a, tdbSNP:138535346
858+c, tdbSNP:201788574
891+a, gdbSNP:367777373
928+a, gdbSNP:146345577
936+c, tdbSNP:374319458
951+c, tdbSNP:77290177
952+a, gdbSNP:368200642
965+a, tdbSNP:372396909
1008+dbSNP:
1008+c, tdbSNP:115500434
1023+c, tdbSNP:201615676
1029+a, gdbSNP:372273946
1038+a, gdbSNP:374030639
1050+a, gdbSNP:146065356
1089+c, tdbSNP:368227905
1111+c, tdbSNP:374666711
1185+dbSNP:
1185+a, gdbSNP:140010893
1215+c, tdbSNP:116493527
1257+dbSNP:
1257+a, cdbSNP:375879544
1269+g, tdbSNP:367663559
1270+c, tdbSNP:144832566
1293+c, tdbSNP:148570725
1320+a, gdbSNP:371832037
1365+a, gdbSNP:142921812
1374+c, tdbSNP:142041325
1418+c, gdbSNP:376777993
1436+c, tdbSNP:13108
1442+a, gdbSNP:200257392
1447+c, tdbSNP:376380531
1484+a, gdbSNP:370715274
1503+c, tdbSNP:1058852
1585+a, gdbSNP:4803366
1626+a, gdbSNP:372105982
Gene SymbolSNRPA
Gene SynonymMud1; U1-A; U1A
Chromosome19
Locus Map19q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004596 Homo sapiens small nuclear ribonucleoprotein polypeptide A (SNRPA), mRNA. In-stock $99.00 5-7
Title U1A regulates 3' processing of the survival motor neuron mRNA .
Author Workman E, Veith A and Battle DJ.
Journal J. Biol. Chem. 289 (6), 3703-3712 (2014)
Title U1A protein-stem loop 2 RNA recognition: prediction of structural differences from protein mutations .
Author Kormos BL, Pieniazek SN, Beveridge DL and Baranger AM.
Journal Biopolymers 95 (9), 591-606 (2011)
Title The small nuclear ribonucleoprotein U1A interacts with NS5 from yellow fever virus .
Author Bronzoni RV, Madrid MC, Duarte DV, Pellegrini VO, Pacca CC, Carmo AC, Zanelli CF, Valentini SR, Santacruz-Perez C, Barbosa JA, Lutz CS, Rahal P and Nogueira ML.
Journal Arch. Virol. 156 (6), 931-938 (2011)
Title Multistep kinetics of the U1A-SL2 RNA complex dissociation .
Author Anunciado D, Dhar A, Gruebele M and Baranger AM.
Journal J. Mol. Biol. 408 (5), 896-908 (2011)
Title Identification of molecular contacts between the U1 A small nuclear ribonucleoprotein and U1 RNA .
Author Jessen TH, Oubridge C, Teo CH, Pritchard C and Nagai K.
Journal EMBO J. 10 (11), 3447-3456 (1991)
Title Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein .
Author Nelissen RL, Sillekens PT, Beijer RP, Geurts van Kessel AH and van Venrooij WJ.
Journal Gene 102 (2), 189-196 (1991)
Title RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins .
Author Hoffman DW, Query CC, Golden BL, White SW and Keene JD.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (6), 2495-2499 (1991)
Title Quantitative determination that one of two potential RNA-binding domains of the A protein component of the U1 small nuclear ribonucleoprotein complex binds with high affinity to stem-loop II of U1 RNA .
Author Lutz-Freyermuth C, Query CC and Keene JD.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (16), 6393-6397 (1990)
Title Assignment of seven genes to distinct intervals on the midportion of human chromosome 19q surrounding the myotonic dystrophy gene region .
Author Schonk D, van Dijk P, Riegmann P, Trapman J, Holm C, Willcocks TC, Sillekens P, van Venrooij W, Wimmer E and Geurts van Kessel A.
Journal Cytogenet. Cell Genet. 54 (1-2), 15-19 (1990)
Title cDNA cloning of the human U1 snRNA-associated A protein: extensive homology between U1 and U2 snRNP-specific proteins .
Author Sillekens PT, Habets WJ, Beijer RP and van Venrooij WJ.
Journal EMBO J. 6 (12), 3841-3848 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.