• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA.


RefSeq Accession Definition Services Price Order
NM_004621 Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA. ORF Sequence $810.84
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004621.5, 170014741
Length 4612 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA.
Product short transient receptor potential channel 6
Comment

Summary: The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009].

RefSeq NP_004612.2
CDS 426..3221
Misc Feature(1)231..233
Misc Feature(2)669..3116
Misc Feature(3)669..3116
Misc Feature(4)714..803
Misc Feature(5)738..1142
Misc Feature(6)819..908
Misc Feature(7)912..992
Misc Feature(8)1077..1166
Misc Feature(9)1182..1370
Misc Feature(10)1740..1802
Misc Feature(11)1887..1949
Misc Feature(12)<1905..2627
Misc Feature(13)1989..2051
Misc Feature(14)2202..2264
Misc Feature(15)2334..2396
Misc Feature(16)2544..2606
Misc Feature(17)2868..2870
Exon (1)1..595
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (2)596..1370
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (3)1371..1553
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (4)1554..1718
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (5)1719..1935
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (6)1936..2169
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (7)2170..2434
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (8)2435..2630
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (9)2631..2834
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (10)2835..2909
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (11)2910..2993
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (12)2994..3069
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (13)3070..4612
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Translation MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE EKSQNTEDLAELIRELGEKLSMEPNQEETNR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-g, cdbSNP:17096920
complement(25)-t, cdbSNP:199629792
complement(34)-g, c, adbSNP:201438554
complement(48)-t, cdbSNP:200207671
complement(56)-g, adbSNP:201876318
complement(61)-c, adbSNP:182475858
complement(65)-t, adbSNP:41302375
complement(66)-g, adbSNP:192759166
complement(74)-g, cdbSNP:201260623
complement(83)-g, cdbSNP:200074836
complement(84)-t, c, adbSNP:202080799
complement(87)-g, adbSNP:200960139
complement(89)-g, adbSNP:199849884
complement(94)-g, adbSNP:201862318
complement(100)-t, cdbSNP:200756064
complement(119)-t, adbSNP:199985330
complement(131)-t, cdbSNP:201878903
complement(140)-g, adbSNP:200876066
complement(171)-g, cdbSNP:199796926
complement(172)-g, cdbSNP:3824934
complement(182)-g, adbSNP:200535998
complement(183)-g, adbSNP:199601311
complement(208)-g, adbSNP:56134796
complement(235)-t, adbSNP:200317692
complement(243)-t, cdbSNP:202021293
complement(254)-g, cdbSNP:201519534
complement(284)-g, adbSNP:200221683
complement(293)-g, cdbSNP:202229148
complement(301)-g, adbSNP:201034657
complement(309)-t, gdbSNP:188637002
complement(321)-t, cdbSNP:199961884
complement(322)-c, adbSNP:184074851
complement(330)-t, gdbSNP:201997708
complement(336)-g, adbSNP:201212575
complement(388)-g, adbSNP:200082005
complement(416)-t, gdbSNP:191383391
complement(426)-t, adbSNP:200791997
complement(456)-t, gdbSNP:199816184
complement(466)-t, gdbSNP:201616541
complement(468)-g, adbSNP:3802829
complement(471)-g, cdbSNP:199684501
complement(500)-g, adbSNP:201051533
complement(509)-g, cdbSNP:200642639
complement(530)-g, adbSNP:199780084
complement(551)-t, gdbSNP:144503726
complement(555)-g, adbSNP:149263696
complement(562)-g, adbSNP:138588871
complement(597)-dbSNP:
complement(597)-g, adbSNP:117273916
complement(598)-t, cdbSNP:202230574
complement(623)-t, gdbSNP:201084042
complement(624)-g, adbSNP:200031940
complement(635)-t, cdbSNP:141153400
complement(638)-t, adbSNP:138123801
complement(642)-g, adbSNP:200138684
complement(658)-t, cdbSNP:201516250
complement(667)-t, cdbSNP:200774833
complement(673)-t, cdbSNP:199497734
complement(675)-t, gdbSNP:202083439
complement(683)-g, adbSNP:200806868
complement(684)-t, cdbSNP:199652243
complement(693)-t, cdbSNP:145652328
complement(696)-g, adbSNP:200186406
complement(698)-g, adbSNP:140496742
complement(707)-g, adbSNP:199785060
complement(717)-t, cdbSNP:201465098
complement(718)-t, adbSNP:200369786
complement(726)-g, adbSNP:201977212
complement(729)-t, adbSNP:201363468
complement(757)-t, adbSNP:200463086
complement(760)-c, adbSNP:121434390
complement(761)-t, gdbSNP:201818043
complement(765)-g, cdbSNP:200841275
complement(768)-g, adbSNP:199884871
complement(776)-t, cdbSNP:201569636
complement(778)-t, adbSNP:141546717
complement(791)-g, adbSNP:201176913
complement(799)-t, cdbSNP:146776939
complement(800)-g, adbSNP:201643083
complement(824)-g, cdbSNP:200976682
complement(846)-c, adbSNP:199798745
complement(851)-t, gdbSNP:201778466
complement(853)-g, adbSNP:121434391
complement(860)-g, adbSNP:200589012
complement(895)-t, gdbSNP:35857503
complement(902)-g, adbSNP:149152923
complement(903)-g, adbSNP:201779770
complement(920)-t, cdbSNP:200475220
complement(924)-g, cdbSNP:199617881
complement(969)-t, cdbSNP:201410126
complement(976)-g, adbSNP:200198559
complement(977)-t, cdbSNP:201872553
complement(994)-t, cdbSNP:201153592
complement(995)-t, cdbSNP:200279626
complement(1025)-t, adbSNP:145358649
complement(1092)-t, cdbSNP:150033580
complement(1098)-g, cdbSNP:201368333
complement(1119)-g, adbSNP:200066139
complement(1136)-t, gdbSNP:140242092
complement(1143)-g, adbSNP:201054988
complement(1148)-c, adbSNP:199854499
complement(1164)-g, adbSNP:201859973
complement(1166)-t, cdbSNP:200751919
complement(1213)-t, gdbSNP:199946947
complement(1233)-t, adbSNP:121434392
complement(1262)-g, adbSNP:147530677
complement(1274)-t, cdbSNP:200701831
complement(1312)-g, adbSNP:199743177
complement(1313)-t, cdbSNP:144891994
complement(1322)-t, cdbSNP:200519787
complement(1323)-g, adbSNP:199597661
complement(1338)-c, adbSNP:201284689
complement(1373)-dbSNP:
complement(1373)-g, adbSNP:139477687
complement(1386)-g, adbSNP:201197962
complement(1398)-c, adbSNP:150706267
complement(1421)-g, adbSNP:200144852
complement(1456)-t, gdbSNP:201993968
complement(1480)-g, adbSNP:200661450
complement(1518)-g, adbSNP:199841405
complement(1577)-dbSNP:
complement(1577)-t, cdbSNP:201355176
complement(1616)-g, adbSNP:141208676
complement(1620)-g, adbSNP:200479189
complement(1621)-t, cdbSNP:199747455
complement(1636)-t, g, adbSNP:36111323
complement(1637)-t, cdbSNP:144085223
complement(1649)-g, adbSNP:199570503
complement(1668)-t, cdbSNP:201549192
complement(1669)-g, adbSNP:142533998
complement(1679)-g, cdbSNP:191073336
complement(1685)-t, cdbSNP:138155461
complement(1710)-g, adbSNP:202114017
complement(1724..1725)-dbSNP:
complement(1724..1725)-, cdbSNP:35722942
complement(1727)-t, cdbSNP:201162800
complement(1730)-t, cdbSNP:185294174
complement(1734)-g, adbSNP:145580926
complement(1735)-t, cdbSNP:199503731
complement(1740)-g, cdbSNP:200144077
complement(1763)-g, adbSNP:112258968
complement(1779)-t, cdbSNP:200539886
complement(1784)-t, adbSNP:138724461
complement(1787)-t, cdbSNP:199503170
complement(1800)-t, cdbSNP:201918314
complement(1827)-t, gdbSNP:200918314
complement(1882)-t, adbSNP:202121529
complement(1942)-dbSNP:
complement(1942)-g, adbSNP:200561342
complement(1975)-t, cdbSNP:200418623
complement(1995)-g, cdbSNP:202166137
complement(1997)-c, adbSNP:201258942
complement(2031)-t, cdbSNP:200486728
complement(2036)-g, adbSNP:150183033
complement(2054)-t, cdbSNP:201064728
complement(2092)-g, cdbSNP:202139115
complement(2103)-t, cdbSNP:199892792
complement(2108)-g, adbSNP:12366144
complement(2164)-t, cdbSNP:201304687
complement(2168)-t, cdbSNP:199985022
complement(2172)-dbSNP:
complement(2172)-t, gdbSNP:200107149
complement(2180)-t, cdbSNP:201767580
complement(2243)-g, adbSNP:139187399
complement(2298)-t, gdbSNP:199577919
complement(2313)-t, gdbSNP:61745699
complement(2316)-t, cdbSNP:200087630
complement(2324)-g, adbSNP:187196477
complement(2434)-g, adbSNP:199992311
complement(2468)-dbSNP:
complement(2468)-g, adbSNP:188810050
complement(2481)-t, adbSNP:200226540
complement(2499)-t, cdbSNP:202219188
complement(2506)-t, cdbSNP:200154450
complement(2509)-t, cdbSNP:201874834
complement(2510)-g, adbSNP:201155995
complement(2513)-g, adbSNP:61739601
complement(2540)-g, adbSNP:61743044
complement(2562)-t, cdbSNP:184304815
complement(2567)-t, c, adbSNP:145077205
complement(2589)-t, cdbSNP:192402680
complement(2615)-t, cdbSNP:200080118
complement(2636)-dbSNP:
complement(2636)-g, adbSNP:200737801
complement(2681)-g, adbSNP:199945898
complement(2702)-t, cdbSNP:201846053
complement(2704)-c, adbSNP:187349423
complement(2714)-g, cdbSNP:200640958
complement(2719)-t, cdbSNP:199786058
complement(2721)-g, cdbSNP:201466403
complement(2724)-t, cdbSNP:200772226
complement(2729)-t, cdbSNP:201608841
complement(2742)-g, cdbSNP:199604557
complement(2743)-g, adbSNP:202002330
complement(2762)-g, cdbSNP:201289003
complement(2770)-t, adbSNP:200319221
complement(2804)-t, gdbSNP:144927067
complement(2817)-g, cdbSNP:201522744
complement(2823)-t, cdbSNP:140980724
complement(2866)-dbSNP:
complement(2866)-t, cdbSNP:138519687
complement(2878)-t, gdbSNP:61732606
complement(2888)-t, adbSNP:199948731
complement(2910)-dbSNP:
complement(2910)-t, cdbSNP:201149400
complement(2913)-t, cdbSNP:199810047
complement(2916)-g, adbSNP:145480038
complement(2929)-t, gdbSNP:202091355
complement(2949)-c, adbSNP:149665208
complement(2954)-g, adbSNP:72984209
complement(2969)-g, adbSNP:61890853
complement(3001)-dbSNP:
complement(3001)-t, adbSNP:112206284
complement(3008)-t, cdbSNP:144883746
complement(3039)-t, cdbSNP:200439671
complement(3041)-t, cdbSNP:199555333
complement(3045)-t, adbSNP:121434393
complement(3092)-dbSNP:
complement(3092)-t, cdbSNP:200033070
complement(3108)-t, cdbSNP:121434394
complement(3110)-g, adbSNP:199747360
complement(3114)-g, adbSNP:121434395
complement(3136)-t, cdbSNP:148529934
complement(3137)-t, cdbSNP:12805398
complement(3146)-t, gdbSNP:199630143
complement(3152)-t, cdbSNP:200142981
complement(3190)-g, adbSNP:200326564
complement(3195)-g, adbSNP:139330011
complement(3196)-t, gdbSNP:201521541
complement(3222)-g, adbSNP:200521132
complement(3224)-g, adbSNP:199566055
complement(3230)-g, adbSNP:187970274
complement(3234)-g, adbSNP:200791047
complement(3257)-g, cdbSNP:199614681
complement(3261)-c, adbSNP:201285907
complement(3270)-g, adbSNP:200164641
complement(3271)-t, cdbSNP:199776453
complement(3283)-c, adbSNP:201397254
complement(3289)-g, adbSNP:200443992
complement(3294)-t, gdbSNP:182894539
complement(3306)-t, cdbSNP:201365433
complement(3343)-g, cdbSNP:200465112
complement(3351)-t, cdbSNP:202214686
complement(3381)-, adbSNP:143334593
complement(3383)-t, cdbSNP:200848085
complement(3396)-t, gdbSNP:199878670
complement(3403)-t, cdbSNP:201923280
complement(3415)-t, cdbSNP:200949645
complement(3433)-c, adbSNP:200028974
complement(3439)-g, adbSNP:190606820
complement(3450)-g, adbSNP:200700133
complement(3504)-c, adbSNP:200131464
complement(3510)-g, adbSNP:201767367
complement(3531)-g, cdbSNP:200582003
complement(3535)-g, cdbSNP:199583740
complement(3548)-t, cdbSNP:201554489
complement(3549)-g, adbSNP:200798325
complement(3557)-g, adbSNP:199619303
complement(3558)-t, cdbSNP:144714163
complement(3562)-g, adbSNP:186981402
complement(3584)-g, cdbSNP:77869343
complement(3585)-t, gdbSNP:76289527
complement(3608)-c, adbSNP:200290996
complement(3620)-t, cdbSNP:201873986
complement(3634)-g, cdbSNP:201216643
complement(3639)-t, gdbSNP:200277648
complement(3641)-t, adbSNP:201691922
complement(3670)-g, adbSNP:201013947
complement(3679)-t, gdbSNP:200142677
complement(3728)-t, adbSNP:202210629
complement(3741)-t, cdbSNP:149303118
complement(3743)-t, cdbSNP:199848259
complement(3751)-g, adbSNP:112916171
complement(3774)-t, c, adbSNP:7931399
complement(3784)-t, cdbSNP:199948421
complement(3788)-t, adbSNP:77809937
complement(3790)-t, gdbSNP:201646103
complement(3795)-c, adbSNP:181225377
complement(3796)-t, gdbSNP:200705719
complement(3801)-c, adbSNP:191323775
complement(3824)-g, adbSNP:199746098
complement(3828)-g, adbSNP:201593795
complement(3831)-t, adbSNP:200709731
complement(3838)-t, cdbSNP:199587164
complement(3866)-t, cdbSNP:201279284
complement(3881..3888)-, gcacacacdbSNP:61621225
complement(3885..3892)-, acacgcacdbSNP:72255315
complement(3888..3895)-, cacacacgdbSNP:141651828
complement(3889)-t, cdbSNP:200307747
complement(3895)-t, cdbSNP:201816418
complement(3928..3929)-, aatadbSNP:34445672
complement(3929..3930)-, aatadbSNP:10634011
complement(3929)-g, adbSNP:201399805
complement(3930..3931)-, taaadbSNP:71784172
complement(3931..3932)-, taaadbSNP:145266305
complement(3932..3933)-, aatadbSNP:146569720
complement(3932)-c, adbSNP:75785415
complement(3948)-t, cdbSNP:202110434
complement(3981)-t, adbSNP:201305463
complement(4002)-t, adbSNP:200312340
complement(4013)-t, cdbSNP:201986308
complement(4017)-g, adbSNP:201204101
complement(4018)-t, adbSNP:200110123
complement(4040)-g, adbSNP:201778272
complement(4043)-g, adbSNP:201038035
complement(4049)-t, gdbSNP:199848029
complement(4054)-g, adbSNP:185948481
complement(4064)-t, adbSNP:201902673
complement(4074)-t, cdbSNP:200907025
complement(4077)-t, cdbSNP:199672759
complement(4087)-t, cdbSNP:201454138
complement(4088)-c, adbSNP:200455010
complement(4116)-t, cdbSNP:199806114
complement(4129)-t, cdbSNP:201574498
complement(4135)-g, cdbSNP:200424891
complement(4136)-t, gdbSNP:199564523
complement(4148)-t, cdbSNP:201590536
complement(4181)-g, cdbSNP:138558920
complement(4191)-t, cdbSNP:146033736
complement(4206)-g, adbSNP:200967055
complement(4209)-g, adbSNP:200161316
complement(4219)-g, adbSNP:202114385
complement(4241)-t, cdbSNP:201292926
complement(4259)-c, adbSNP:142655335
complement(4266)-c, adbSNP:116690727
complement(4292)-t, cdbSNP:200962334
complement(4310)-t, g, adbSNP:117895343
complement(4323)-c, adbSNP:201507457
complement(4343)-c, adbSNP:200519679
complement(4394)-g, adbSNP:199599758
complement(4396)-t, gdbSNP:201908752
complement(4443)-g, adbSNP:200913575
complement(4444)-c, adbSNP:199619957
complement(4457)-t, gdbSNP:201525749
complement(4464)-t, cdbSNP:200167775
complement(4502)-g, adbSNP:199773299
complement(4570)-g, adbSNP:180930016
complement(4609)-t, cdbSNP:189149644
Gene SymbolTRPC6
Gene SynonymFSGS2; TRP6
Chromosome11
Locus Map11q22.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004621 Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA. Full Length $1614.20
ORF Sequence $810.84
Title Pulsatile atheroprone shear stress affects the expression of transient receptor potential channels in human endothelial cells .
Author Thilo,F., Vorderwulbecke,B.J., Marki,A., Krueger,K., Liu,Y., Baumunk,D., Zakrzewicz,A. and Tepel,M.
Journal Hypertension 59 (6), 1232-1240 (2012)
Title The upregulation of TRPC6 contributes to Ca(2)(+) signaling and actin assembly in human mesangial cells after chronic hypoxia .
Author Liao,C., Yang,H., Zhang,R., Sun,H., Zhao,B., Gao,C., Zhu,F. and Jiao,J.
Journal Biochem. Biophys. Res. Commun. 421 (4), 750-756 (2012)
Title Involvement of phosphoinositide 3-kinase and PTEN protein in mechanism of activation of TRPC6 protein in vascular smooth muscle cells .
Author Monet,M., Francoeur,N. and Boulay,G.
Journal J. Biol. Chem. 287 (21), 17672-17681 (2012)
Title Diacylglycerol-containing oleic acid induces increases in [Ca(2+)](i) via TRPC3/6 channels in human T-cells .
Author Carrillo,C., Hichami,A., Andreoletti,P., Cherkaoui-Malki,M., del Mar Cavia,M., Abdoul-Azize,S., Alonso-Torre,S.R. and Khan,N.A.
Journal Biochim. Biophys. Acta 1821 (4), 618-626 (2012)
Title TRPC6 gene variants in Czech adult patients with focal segmental glomerulosclerosis and minimal change disease .
Author Obeidova,L., Reiterova,J., Lnenicka,P., Stekrova,J., Safrankova,H., Kohoutova,M. and Tesar,V.
Journal Folia Biol. (Praha) 58 (4), 173-176 (2012)
Title TRP4 (CCE1) protein is part of native calcium release-activated Ca2+-like channels in adrenal cells .
Author Philipp,S., Trost,C., Warnat,J., Rautmann,J., Himmerkus,N., Schroth,G., Kretz,O., Nastainczyk,W., Cavalie,A., Hoth,M. and Flockerzi,V.
Journal J. Biol. Chem. 275 (31), 23965-23972 (2000)
Title Modulation of Ca(2+) entry by polypeptides of the inositol 1,4, 5-trisphosphate receptor (IP3R) that bind transient receptor potential (TRP): evidence for roles of TRP and IP3R in store depletion-activated Ca(2+) entry .
Author Boulay,G., Brown,D.M., Qin,N., Jiang,M., Dietrich,A., Zhu,M.X., Chen,Z., Birnbaumer,M., Mikoshiba,K. and Birnbaumer,L.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (26), 14955-14960 (1999)
Title Linkage of a gene causing familial focal segmental glomerulosclerosis to chromosome 11 and further evidence of genetic heterogeneity .
Author Winn,M.P., Conlon,P.J., Lynn,K.L., Howell,D.N., Slotterbeck,B.D., Smith,A.H., Graham,F.L., Bembe,M., Quarles,L.D., Pericak-Vance,M.A. and Vance,J.M.
Journal Genomics 58 (2), 113-120 (1999)
Title Direct activation of human TRPC6 and TRPC3 channels by diacylglycerol .
Author Hofmann,T., Obukhov,A.G., Schaefer,M., Harteneck,C., Gudermann,T. and Schultz,G.
Journal Nature 397 (6716), 259-263 (1999)
Title Identification and assignment of the human transient receptor potential channel 6 gene TRPC6 to chromosome 11q21-->q22 .
Author D'Esposito,M., Strazzullo,M., Cuccurese,M., Spalluto,C., Rocchi,M., D'Urso,M. and Ciccodicola,A.
Journal Cytogenet. Cell Genet. 83 (1-2), 46-47 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878