• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23592 Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu23592C Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004621.5, 170014741
Length 2796 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens transient receptor potential cation channel, subfamily C, member 6 (TRPC6), mRNA.
Product short transient receptor potential channel 6
Comment

Summary: The protein encoded by this gene forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2). [provided by RefSeq, Mar 2009].

RefSeq NP_004612.2
CDS 426..3221
Misc Feature(1)231..233
Misc Feature(2)669..3116
Misc Feature(3)669..3116
Misc Feature(4)714..803
Misc Feature(5)738..1142
Misc Feature(6)819..908
Misc Feature(7)912..992
Misc Feature(8)1077..1166
Misc Feature(9)1182..1370
Misc Feature(10)1740..1802
Misc Feature(11)1887..1949
Misc Feature(12)1989..2051
Misc Feature(13)2202..2264
Misc Feature(14)2334..2396
Misc Feature(15)2544..2606
Misc Feature(16)2868..2870
Exon (1)1..595
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (2)596..1370
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (3)1371..1553
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (4)1554..1718
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (5)1719..1935
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (6)1936..2169
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (7)2170..2434
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (8)2435..2630
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (9)2631..2834
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (10)2835..2909
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (11)2910..2993
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (12)2994..3069
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Exon (13)3070..4612
Gene:TRPC6
Gene Synonym:FSGS2; TRP6
Translation MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCYGYYPCFRGS DNRLAHRRQTVLREKGRRLANRGPAYMFSDRSTSLSIEEERFLDAAEYGNIPVVRKMLEE CHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAI LSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLR KGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALEL SNELAVLANIEKEFKNDYKKLSMQCKDFVVGLLDLCRNTEEVEAILNGDVETLQSGDHGR PNLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFL ALIYWFAPCSKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNA KQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAAS FIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQIISEGLYA IAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYI GAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLL NMLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLFYLLLKL KKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSS EDFHLNSFNNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLE EKSQNTEDLAELIRELGEKLSMEPNQEETNR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(2)-dbSNP:
complement(2)-g, cdbSNP:17096920
complement(25)-t, cdbSNP:199629792
complement(34)-g, c, adbSNP:201438554
complement(48)-t, cdbSNP:200207671
complement(51)-t, cdbSNP:374678674
complement(56)-g, adbSNP:201876318
complement(61)-c, adbSNP:182475858
complement(65)-t, adbSNP:41302375
complement(66)-g, adbSNP:192759166
complement(74)-g, cdbSNP:201260623
complement(83)-g, cdbSNP:200074836
complement(84)-t, c, adbSNP:202080799
complement(87)-g, adbSNP:200960139
complement(89)-g, adbSNP:199849884
complement(94)-g, adbSNP:201862318
complement(100)-t, cdbSNP:200756064
complement(119)-t, adbSNP:199985330
complement(131)-t, cdbSNP:201878903
complement(140)-g, adbSNP:200876066
complement(171)-g, cdbSNP:199796926
complement(172)-g, cdbSNP:3824934
complement(182)-g, adbSNP:200535998
complement(183)-g, adbSNP:199601311
complement(208)-g, adbSNP:56134796
complement(235)-t, adbSNP:200317692
complement(243)-t, cdbSNP:202021293
complement(252)-t, cdbSNP:370163860
complement(254)-g, cdbSNP:201519534
complement(284)-g, adbSNP:200221683
complement(293)-g, cdbSNP:202229148
complement(301)-g, adbSNP:201034657
complement(309)-t, gdbSNP:188637002
complement(321)-t, cdbSNP:199961884
complement(322)-c, adbSNP:184074851
complement(330)-t, gdbSNP:201997708
complement(336)-g, adbSNP:201212575
complement(388)-g, adbSNP:200082005
complement(416)-t, gdbSNP:191383391
complement(426)-t, adbSNP:200791997
complement(456)-t, gdbSNP:199816184
complement(466)-t, gdbSNP:201616541
complement(468)-g, adbSNP:3802829
complement(471)-g, cdbSNP:199684501
complement(500)-g, adbSNP:201051533
complement(509)-g, cdbSNP:200642639
complement(530)-g, adbSNP:199780084
complement(532)-g, adbSNP:371074397
complement(539)-t, cdbSNP:374371372
complement(551)-t, gdbSNP:144503726
complement(555)-g, adbSNP:149263696
complement(562)-g, adbSNP:138588871
complement(597)-dbSNP:
complement(597)-g, adbSNP:117273916
complement(598)-t, cdbSNP:202230574
complement(623)-t, gdbSNP:201084042
complement(624)-g, adbSNP:200031940
complement(626)-t, cdbSNP:372852515
complement(628)-t, cdbSNP:369866012
complement(635)-t, cdbSNP:141153400
complement(638)-t, adbSNP:138123801
complement(642)-g, adbSNP:200138684
complement(643)-c, adbSNP:371919016
complement(658)-t, cdbSNP:201516250
complement(667)-t, cdbSNP:200774833
complement(673)-t, cdbSNP:199497734
complement(675)-t, gdbSNP:202083439
complement(683)-g, adbSNP:200806868
complement(684)-t, cdbSNP:199652243
complement(693)-t, cdbSNP:145652328
complement(696)-g, adbSNP:200186406
complement(698)-g, adbSNP:140496742
complement(707)-g, adbSNP:199785060
complement(717)-t, cdbSNP:201465098
complement(718)-t, adbSNP:200369786
complement(722)-t, cdbSNP:371593994
complement(726)-g, adbSNP:201977212
complement(728)-g, cdbSNP:367841560
complement(729)-t, adbSNP:201363468
complement(757)-t, adbSNP:200463086
760+a, cdbSNP:121434390
complement(761)-t, gdbSNP:201818043
complement(765)-g, cdbSNP:200841275
complement(768)-g, adbSNP:199884871
complement(776)-t, cdbSNP:201569636
complement(778)-t, adbSNP:141546717
complement(791)-g, adbSNP:201176913
complement(799)-t, cdbSNP:146776939
complement(800)-g, adbSNP:201643083
complement(801)-t, cdbSNP:370656422
complement(824)-g, cdbSNP:200976682
complement(831)-t, cdbSNP:377323677
complement(846)-c, adbSNP:199798745
complement(851)-t, gdbSNP:201778466
853+a, gdbSNP:121434391
complement(860)-g, adbSNP:200589012
complement(869)-t, adbSNP:372998438
complement(895)-t, gdbSNP:35857503
complement(902)-g, adbSNP:149152923
complement(903)-g, adbSNP:201779770
complement(920)-t, cdbSNP:200475220
complement(921)-t, gdbSNP:368241822
complement(924)-g, cdbSNP:199617881
complement(969)-t, cdbSNP:201410126
complement(976)-g, adbSNP:200198559
complement(977)-t, cdbSNP:201872553
complement(994)-t, cdbSNP:201153592
complement(995)-t, cdbSNP:200279626
complement(1025)-t, adbSNP:145358649
complement(1029)-t, gdbSNP:267602665
complement(1067)-t, cdbSNP:369124216
complement(1092)-t, cdbSNP:150033580
complement(1098)-g, cdbSNP:201368333
complement(1119)-g, adbSNP:200066139
complement(1136)-t, gdbSNP:140242092
complement(1143)-g, adbSNP:201054988
complement(1148)-g, c, adbSNP:199854499
complement(1164)-g, adbSNP:201859973
complement(1166)-t, cdbSNP:200751919
complement(1213)-t, gdbSNP:199946947
complement(1223)-t, cdbSNP:370013734
1233+a, tdbSNP:121434392
complement(1262)-g, adbSNP:147530677
complement(1274)-t, cdbSNP:200701831
complement(1296)-t, cdbSNP:375722338
complement(1312)-g, adbSNP:199743177
complement(1313)-t, cdbSNP:144891994
complement(1322)-t, cdbSNP:200519787
complement(1323)-g, adbSNP:199597661
complement(1338)-c, adbSNP:201284689
complement(1373)-dbSNP:
complement(1373)-g, adbSNP:139477687
complement(1386)-g, adbSNP:201197962
complement(1398)-c, adbSNP:150706267
complement(1421)-g, adbSNP:200144852
complement(1456)-t, gdbSNP:201993968
complement(1480)-g, adbSNP:200661450
complement(1518)-g, adbSNP:199841405
complement(1577)-dbSNP:
complement(1577)-t, cdbSNP:201355176
complement(1616)-g, adbSNP:141208676
complement(1620)-g, adbSNP:200479189
complement(1621)-t, cdbSNP:199747455
complement(1634)-t, cdbSNP:374441143
complement(1636)-t, g, adbSNP:36111323
complement(1637)-t, cdbSNP:144085223
complement(1649)-g, adbSNP:199570503
complement(1668)-t, cdbSNP:201549192
complement(1669)-g, adbSNP:142533998
complement(1679)-g, cdbSNP:191073336
complement(1685)-t, cdbSNP:138155461
complement(1710)-g, adbSNP:202114017
complement(1724..1725)-dbSNP:
complement(1724..1725)-, cdbSNP:35722942
complement(1727)-t, cdbSNP:201162800
complement(1730)-t, cdbSNP:185294174
complement(1734)-g, adbSNP:145580926
complement(1735)-t, cdbSNP:199503731
complement(1740)-g, cdbSNP:200144077
complement(1757)-t, cdbSNP:375606364
complement(1763)-g, adbSNP:112258968
complement(1779)-t, cdbSNP:200539886
complement(1784)-t, adbSNP:138724461
complement(1787)-t, cdbSNP:199503170
complement(1800)-t, cdbSNP:201918314
complement(1827)-t, gdbSNP:200918314
complement(1850)-g, adbSNP:374866314
complement(1882)-t, adbSNP:202121529
complement(1942)-dbSNP:
complement(1942)-g, adbSNP:200561342
complement(1975)-t, cdbSNP:200418623
complement(1995)-g, cdbSNP:202166137
complement(1997)-c, adbSNP:201258942
complement(2008)-g, adbSNP:371603665
complement(2031)-t, cdbSNP:200486728
complement(2036)-g, adbSNP:150183033
complement(2045)-t, gdbSNP:367860227
complement(2054)-t, cdbSNP:201064728
complement(2092)-g, cdbSNP:202139115
complement(2103)-t, cdbSNP:199892792
complement(2108)-g, adbSNP:12366144
complement(2111)-g, adbSNP:375248575
complement(2123)-g, adbSNP:370821915
complement(2134)-g, adbSNP:368012446
complement(2164)-t, cdbSNP:201304687
complement(2168)-t, cdbSNP:199985022
complement(2172)-dbSNP:
complement(2172)-t, gdbSNP:200107149
complement(2175)-t, adbSNP:370639681
complement(2180)-t, cdbSNP:201767580
complement(2243)-g, adbSNP:139187399
complement(2298)-t, gdbSNP:199577919
complement(2313)-t, gdbSNP:61745699
complement(2316)-t, cdbSNP:200087630
complement(2324)-g, adbSNP:187196477
complement(2434)-g, adbSNP:199992311
complement(2468)-dbSNP:
complement(2468)-g, adbSNP:188810050
complement(2481)-t, adbSNP:200226540
complement(2499)-t, cdbSNP:202219188
complement(2506)-t, cdbSNP:200154450
complement(2509)-t, cdbSNP:201874834
complement(2510)-g, adbSNP:201155995
complement(2513)-g, adbSNP:61739601
complement(2540)-g, adbSNP:61743044
complement(2562)-t, cdbSNP:184304815
complement(2567)-t, c, adbSNP:145077205
complement(2589)-t, cdbSNP:192402680
complement(2615)-t, cdbSNP:200080118
complement(2636)-dbSNP:
complement(2636)-g, adbSNP:200737801
complement(2681)-g, adbSNP:199945898
complement(2702)-t, cdbSNP:201846053
complement(2704)-c, adbSNP:187349423
complement(2714)-g, cdbSNP:200640958
complement(2719)-t, cdbSNP:199786058
complement(2721)-g, cdbSNP:201466403
complement(2723)-g, cdbSNP:369663658
complement(2724)-t, cdbSNP:200772226
complement(2729)-t, cdbSNP:201608841
complement(2742)-g, cdbSNP:199604557
complement(2743)-g, adbSNP:202002330
complement(2762)-g, cdbSNP:201289003
complement(2770)-t, adbSNP:200319221
complement(2804)-t, gdbSNP:144927067
complement(2817)-g, cdbSNP:201522744
complement(2823)-t, cdbSNP:140980724
complement(2866)-dbSNP:
complement(2866)-t, cdbSNP:138519687
complement(2878)-t, gdbSNP:61732606
complement(2883)-g, adbSNP:373372163
complement(2888)-t, adbSNP:199948731
complement(2910)-dbSNP:
complement(2910)-t, cdbSNP:201149400
complement(2913)-t, cdbSNP:199810047
complement(2916)-g, adbSNP:145480038
complement(2929)-t, gdbSNP:202091355
complement(2933)-g, adbSNP:377172208
complement(2949)-c, adbSNP:149665208
complement(2954)-g, adbSNP:72984209
complement(2962)-t, cdbSNP:367972007
complement(2969)-t, g, adbSNP:61890853
complement(2980)-g, adbSNP:370081781
complement(3001)-dbSNP:
complement(3001)-t, adbSNP:112206284
complement(3008)-t, cdbSNP:144883746
complement(3039)-t, cdbSNP:200439671
complement(3041)-t, cdbSNP:199555333
3045+a, tdbSNP:121434393
complement(3081)-dbSNP:
complement(3081)-t, cdbSNP:267602664
complement(3092)-t, cdbSNP:200033070
3108+c, tdbSNP:121434394
complement(3110)-g, adbSNP:199747360
3114+a, gdbSNP:121434395
complement(3136)-t, cdbSNP:148529934
complement(3137)-t, cdbSNP:12805398
complement(3146)-t, gdbSNP:199630143
complement(3152)-t, cdbSNP:200142981
complement(3190)-g, adbSNP:200326564
complement(3195)-g, adbSNP:139330011
complement(3196)-t, gdbSNP:201521541
complement(3222)-g, adbSNP:200521132
complement(3224)-g, adbSNP:199566055
complement(3225)-t, cdbSNP:376340717
complement(3230)-g, adbSNP:187970274
complement(3234)-g, adbSNP:200791047
complement(3245)-t, cdbSNP:369102556
complement(3257)-g, cdbSNP:199614681
complement(3261)-c, adbSNP:201285907
complement(3270)-g, adbSNP:200164641
complement(3271)-t, cdbSNP:199776453
complement(3283)-c, adbSNP:201397254
complement(3289)-g, adbSNP:200443992
complement(3294)-t, gdbSNP:182894539
complement(3306)-t, cdbSNP:201365433
complement(3343)-g, cdbSNP:200465112
complement(3351)-t, cdbSNP:202214686
complement(3381)-, adbSNP:143334593
complement(3383)-t, cdbSNP:200848085
complement(3396)-t, gdbSNP:199878670
complement(3403)-t, cdbSNP:201923280
complement(3415)-t, cdbSNP:200949645
complement(3433)-c, adbSNP:200028974
complement(3439)-g, adbSNP:190606820
complement(3450)-g, adbSNP:200700133
complement(3504)-c, adbSNP:200131464
complement(3510)-g, adbSNP:201767367
complement(3531)-g, cdbSNP:200582003
complement(3535)-g, cdbSNP:199583740
complement(3540)-t, cdbSNP:371024836
complement(3548)-t, cdbSNP:201554489
complement(3549)-g, adbSNP:200798325
complement(3557)-g, adbSNP:199619303
complement(3558)-t, cdbSNP:144714163
complement(3562)-g, adbSNP:186981402
complement(3584)-g, cdbSNP:77869343
complement(3585)-t, gdbSNP:76289527
complement(3608)-c, adbSNP:200290996
complement(3620)-t, cdbSNP:201873986
complement(3634)-g, cdbSNP:201216643
complement(3639)-t, gdbSNP:200277648
complement(3641)-t, adbSNP:201691922
complement(3670)-g, adbSNP:201013947
complement(3679)-t, gdbSNP:200142677
complement(3728)-t, adbSNP:202210629
complement(3732..3733)-, taagdbSNP:372554917
complement(3741)-t, cdbSNP:149303118
complement(3743)-t, cdbSNP:199848259
complement(3751)-g, adbSNP:112916171
complement(3774)-t, c, adbSNP:7931399
complement(3784)-t, cdbSNP:199948421
complement(3788)-t, adbSNP:77809937
complement(3790)-t, gdbSNP:201646103
complement(3795)-c, adbSNP:181225377
complement(3796)-t, gdbSNP:200705719
complement(3801)-c, adbSNP:191323775
complement(3824)-g, adbSNP:199746098
complement(3828)-g, adbSNP:201593795
complement(3831)-t, adbSNP:200709731
complement(3838)-t, cdbSNP:199587164
complement(3866)-t, cdbSNP:201279284
complement(3881..3888)-, gcacacacdbSNP:61621225
complement(3888..3895)-, cacacacgdbSNP:141651828
complement(3889)-t, cdbSNP:200307747
complement(3895)-t, cdbSNP:201816418
complement(3929..3930)-, aatadbSNP:10634011
complement(3929)-g, adbSNP:201399805
complement(3930..3931)-, taaadbSNP:71784172
complement(3931..3932)-, taaadbSNP:145266305
complement(3932..3933)-, aatadbSNP:146569720
complement(3932)-c, adbSNP:75785415
complement(3948)-t, cdbSNP:202110434
complement(3968)-t, cdbSNP:373667144
complement(3981)-t, adbSNP:201305463
complement(4002)-t, adbSNP:200312340
complement(4013)-t, cdbSNP:201986308
complement(4017)-g, adbSNP:201204101
complement(4018)-t, adbSNP:200110123
complement(4040)-g, adbSNP:201778272
complement(4043)-g, adbSNP:201038035
complement(4049)-t, gdbSNP:199848029
complement(4054)-g, adbSNP:185948481
complement(4064)-t, adbSNP:201902673
complement(4074)-t, cdbSNP:200907025
complement(4077)-t, cdbSNP:199672759
complement(4087)-t, cdbSNP:201454138
complement(4088)-c, adbSNP:200455010
complement(4116)-t, cdbSNP:199806114
complement(4129)-t, cdbSNP:201574498
complement(4135)-g, cdbSNP:200424891
complement(4136)-t, gdbSNP:199564523
complement(4148)-t, cdbSNP:201590536
complement(4181)-g, cdbSNP:138558920
complement(4191)-t, cdbSNP:146033736
complement(4206)-g, adbSNP:200967055
complement(4209)-g, adbSNP:200161316
complement(4219)-g, adbSNP:202114385
complement(4241)-t, cdbSNP:201292926
complement(4259)-c, adbSNP:142655335
complement(4266)-c, adbSNP:116690727
complement(4292)-t, cdbSNP:200962334
complement(4310)-t, g, adbSNP:117895343
complement(4323)-c, adbSNP:201507457
complement(4343)-c, adbSNP:200519679
complement(4394)-g, adbSNP:199599758
complement(4396)-t, gdbSNP:201908752
complement(4443)-g, adbSNP:200913575
complement(4444)-c, adbSNP:199619957
complement(4457)-t, gdbSNP:201525749
complement(4464)-t, cdbSNP:200167775
complement(4502)-g, adbSNP:199773299
complement(4570)-g, adbSNP:180930016
complement(4607)-g, cdbSNP:375701506
complement(4609)-t, cdbSNP:189149644
Gene SymbolTRPC6
Gene SynonymFSGS2; TRP6
Chromosome11
Locus Map11q22.1
Title Combined TRPC3 and TRPC6 blockade by selective small-molecule or genetic deletion inhibits pathological cardiac hypertrophy .
Author Seo K, Rainer PP, Shalkey Hahn V, Lee DI, Jo SH, Andersen A, Liu T, Xu X, Willette RN, Lepore JJ, Marino JP Jr, Birnbaumer L, Schnackenberg CG and Kass DA.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (4), 1551-1556 (2014)
Title Pdx-1 activates islet alpha- and beta-cell proliferation via a mechanism regulated by transient receptor potential cation channels 3 and 6 and extracellular signal-regulated kinases 1 and 2 .
Author Hayes HL, Moss LG, Schisler JC, Haldeman JM, Zhang Z, Rosenberg PB, Newgard CB and Hohmeier HE.
Journal Mol. Cell. Biol. 33 (20), 4017-4029 (2013)
Title Atrial natriuretic peptide-mediated inhibition of microcirculatory endothelial Ca2+ and permeability response to histamine involves cGMP-dependent protein kinase I and TRPC6 channels .
Author Chen W, Oberwinkler H, Werner F, Gassner B, Nakagawa H, Feil R, Hofmann F, Schlossmann J, Dietrich A, Gudermann T, Nishida M, Del Galdo S, Wieland T and Kuhn M.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (9), 2121-2129 (2013)
Title p53 increases intra-cellular calcium release by transcriptional regulation of calcium channel TRPC6 in GaQ3-treated cancer cells .
Author Madan E, Gogna R, Keppler B and Pati U.
Journal PLoS ONE 8 (8), E71016 (2013)
Title Critical role of TRPC6 channels in the development of human renal cell carcinoma .
Author Song J, Wang Y, Li X, Shen Y, Yin M, Guo Y, Diao L, Liu Y and Yue D.
Journal Mol. Biol. Rep. 40 (8), 5115-5122 (2013)
Title TRP4 (CCE1) protein is part of native calcium release-activated Ca2+-like channels in adrenal cells .
Author Philipp S, Trost C, Warnat J, Rautmann J, Himmerkus N, Schroth G, Kretz O, Nastainczyk W, Cavalie A, Hoth M and Flockerzi V.
Journal J. Biol. Chem. 275 (31), 23965-23972 (2000)
Title Modulation of Ca(2+) entry by polypeptides of the inositol 1,4, 5-trisphosphate receptor (IP3R) that bind transient receptor potential (TRP): evidence for roles of TRP and IP3R in store depletion-activated Ca(2+) entry .
Author Boulay G, Brown DM, Qin N, Jiang M, Dietrich A, Zhu MX, Chen Z, Birnbaumer M, Mikoshiba K and Birnbaumer L.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (26), 14955-14960 (1999)
Title Linkage of a gene causing familial focal segmental glomerulosclerosis to chromosome 11 and further evidence of genetic heterogeneity .
Author Winn MP, Conlon PJ, Lynn KL, Howell DN, Slotterbeck BD, Smith AH, Graham FL, Bembe M, Quarles LD, Pericak-Vance MA and Vance JM.
Journal Genomics 58 (2), 113-120 (1999)
Title Direct activation of human TRPC6 and TRPC3 channels by diacylglycerol .
Author Hofmann T, Obukhov AG, Schaefer M, Harteneck C, Gudermann T and Schultz G.
Journal Nature 397 (6716), 259-263 (1999)
Title Identification and assignment of the human transient receptor potential channel 6 gene TRPC6 to chromosome 11q21-->q22 .
Author D'Esposito M, Strazzullo M, Cuccurese M, Spalluto C, Rocchi M, D'Urso M and Ciccodicola A.
Journal Cytogenet. Cell Genet. 83 (1-2), 46-47 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.