• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004629 Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_004629.1, 4759335
Length 2649 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA.
Product Fanconi anemia group G protein
Comment

Summary: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group G. [provided by RefSeq, Jul 2008].

RefSeq NP_004620.1
CDS 493..2361
Misc Feature(1)454..456
Misc Feature(2)511..513
Misc Feature(3)511..513
Misc Feature(4)1228..1329
Misc Feature(5)1522..1623
Misc Feature(6)1639..1641
Misc Feature(7)1651..1653
Misc Feature(8)1849..1950
Misc Feature(9)2032..2133
Exon (1)1..576
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (2)577..667
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (3)668..799
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (4)800..1002
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (5)1003..1138
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (6)1139..1269
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (7)1270..1416
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (8)1417..1568
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (9)1569..1635
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (10)1636..1925
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (11)1926..1972
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (12)1973..2128
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (13)2129..2252
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (14)2253..2631
Gene:FANCG
Gene Synonym:FAG; XRCC9
Translation MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL PAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRE LWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLL LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLC PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL ESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRA GDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL ELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLS VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWI RPSDRDAFLEEFRTSLPKSCDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-c, adbSNP:10972303
complement(40..41)-, tdbSNP:16935545
complement(101)-t, cdbSNP:10972302
complement(512)-t, cdbSNP:35984312
complement(547)-t, cdbSNP:186641344
complement(569)-t, cdbSNP:200677800
complement(578)-dbSNP:
complement(578)-c, adbSNP:199508085
complement(618)-g, cdbSNP:138331241
complement(682)-dbSNP:
complement(682)-t, gdbSNP:34821298
complement(730)-g, adbSNP:115131067
complement(805)-dbSNP:
complement(805)-t, gdbSNP:121434425
complement(867)-g, cdbSNP:199754122
complement(891)-t, cdbSNP:200278002
complement(913)-g, adbSNP:201153812
complement(940)-t, adbSNP:202114813
complement(950)-g, cdbSNP:200074432
complement(955)-g, adbSNP:200926249
complement(956)-t, cdbSNP:201099560
complement(970)-t, cdbSNP:140534765
complement(1132)-dbSNP:
complement(1132)-g, adbSNP:61757385
complement(1161)-dbSNP:
complement(1161)-t, cdbSNP:143230416
complement(1197)-t, cdbSNP:148910563
complement(1214)-g, adbSNP:201438531
complement(1221)-g, adbSNP:199736443
complement(1231)-t, gdbSNP:145613634
complement(1239)-t, cdbSNP:1043957
complement(1279)-dbSNP:
complement(1279)-g, adbSNP:149721361
complement(1290)-t, cdbSNP:200673434
complement(1373)-g, adbSNP:17880082
complement(1382)-g, adbSNP:2237857
complement(1389..1390)-, cdbSNP:34504701
complement(1397)-c, adbSNP:61757386
complement(1445)-dbSNP:
complement(1445)-g, adbSNP:147594292
complement(1448)-g, adbSNP:202152417
complement(1449..1450)-, gdbSNP:34100177
complement(1449)-g, cdbSNP:145092954
complement(1480)-t, cdbSNP:4986940
complement(1558)-t, cdbSNP:121434426
complement(1562)-g, adbSNP:112854819
complement(1625)-dbSNP:
complement(1625)-g, adbSNP:4986939
complement(1649)-dbSNP:
complement(1649)-g, cdbSNP:141147618
complement(1650)-g, cdbSNP:201041980
complement(1780)-g, adbSNP:17881054
complement(1789)-g, adbSNP:183777537
complement(1820)-t, cdbSNP:191508370
complement(1824)-c, adbSNP:200456325
complement(1859)-t, adbSNP:148808709
complement(1914)-g, adbSNP:144369518
complement(1945)-dbSNP:
complement(1945)-g, adbSNP:201884798
complement(1946)-t, cdbSNP:77152961
complement(2012)-dbSNP:
complement(2012)-g, adbSNP:138395184
complement(2030)-g, adbSNP:17885240
complement(2037)-g, adbSNP:201422773
complement(2038)-t, cdbSNP:199833626
complement(2130)-dbSNP:
complement(2130)-t, cdbSNP:45537335
complement(2181)-g, cdbSNP:138855718
complement(2210)-c, adbSNP:200466062
complement(2300)-dbSNP:
complement(2300)-t, cdbSNP:17878854
complement(2333)-g, adbSNP:150203467
complement(2400)-t, cdbSNP:56405035
complement(2410)-g, adbSNP:148311161
complement(2444)-, cdbSNP:35057847
complement(2527)-g, cdbSNP:190050556
complement(2574)-g, adbSNP:185360895
complement(2612)-g, adbSNP:17878564
Gene SymbolFANCG
Gene SynonymFAG; XRCC9
Chromosome9
Locus Map9p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004629 Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA. On-demand $849.00 20
Title Areca nut induces miR-23a and inhibits repair of DNA double-strand breaks by targeting FANCG .
Author Tsai,Y.S., Lin,C.S., Chiang,S.L., Lee,C.H., Lee,K.W. and Ko,Y.C.
Journal Toxicol. Sci. 123 (2), 480-490 (2011)
Title Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk .
Author Monsees,G.M., Kraft,P., Chanock,S.J., Hunter,D.J. and Han,J.
Journal Breast Cancer Res. Treat. 125 (1), 207-214 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title The Fanconi anemia protein, FANCG, binds to the ERCC1-XPF endonuclease via its tetratricopeptide repeats and the central domain of ERCC1 .
Author Wang,C. and Lambert,M.W.
Journal Biochemistry 49 (26), 5560-5569 (2010)
Title Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer .
Author Lipkin,S.M., Chao,E.C., Moreno,V., Rozek,L.S., Rennert,H., Pinchev,M., Dizon,D., Rennert,G., Kopelovich,L. and Gruber,S.B.
Journal Cancer Prev Res (Phila) 3 (5), 597-603 (2010)
Title Rare germinal unequal crossing-over leading to recombinant gene formation and gene duplication in Arabidopsis thaliana .
Author Jelesko,J.G., Harper,R., Furuya,M. and Gruissem,W.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (18), 10302-10307 (1999)
Title Fanconi anemia proteins FANCA, FANCC, and FANCG/XRCC9 interact in a functional nuclear complex .
Author Garcia-Higuera,I., Kuang,Y., Naf,D., Wasik,J. and D'Andrea,A.D.
Journal Mol. Cell. Biol. 19 (7), 4866-4873 (1999)
Title The Fanconi anaemia group G gene FANCG is identical with XRCC9 .
Author de Winter,J.P., Waisfisz,Q., Rooimans,M.A., van Berkel,C.G., Bosnoyan-Collins,L., Alon,N., Carreau,M., Bender,O., Demuth,I., Schindler,D., Pronk,J.C., Arwert,F., Hoehn,H., Digweed,M., Buchwald,M. and Joenje,H.
Journal Nat. Genet. 20 (3), 281-283 (1998)
Title Evidence for at least eight Fanconi anemia genes .
Author Joenje,H., Oostra,A.B., Wijker,M., di Summa,F.M., van Berkel,C.G., Rooimans,M.A., Ebell,W., van Weel,M., Pronk,J.C., Buchwald,M. and Arwert,F.
Journal Am. J. Hum. Genet. 61 (4), 940-944 (1997)
Title The human XRCC9 gene corrects chromosomal instability and mutagen sensitivities in CHO UV40 cells .
Author Liu,N., Lamerdin,J.E., Tucker,J.D., Zhou,Z.Q., Walter,C.A., Albala,J.S., Busch,D.B. and Thompson,L.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (17), 9232-9237 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.