• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25922 Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu25922C Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004629.1, 4759335
Length 1869 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens Fanconi anemia, complementation group G (FANCG), mRNA.
Product Fanconi anemia group G protein
Comment

Summary: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group G. [provided by RefSeq, Jul 2008].

RefSeq NP_004620.1
CDS 493..2361
Misc Feature(1)454..456
Misc Feature(2)511..513
Misc Feature(3)511..513
Misc Feature(4)1228..1329
Misc Feature(5)1522..1623
Misc Feature(6)1639..1641
Misc Feature(7)1651..1653
Misc Feature(8)1849..1950
Misc Feature(9)2032..2133
Exon (1)1..576
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (2)577..667
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (3)668..799
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (4)800..1002
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (5)1003..1138
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (6)1139..1269
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (7)1270..1416
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (8)1417..1568
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (9)1569..1635
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (10)1636..1925
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (11)1926..1972
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (12)1973..2128
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (13)2129..2252
Gene:FANCG
Gene Synonym:FAG; XRCC9
Exon (14)2253..2631
Gene:FANCG
Gene Synonym:FAG; XRCC9
Translation MSRQTTSVGSSCLDLWREKNDRLVRQAKVAQNSGLTLRRQQLAQDALEGLRGLLHSLQGL PAAVPVLPLELTVTCNFIILRASLAQGFTEDQAQDIQRSLERVLETQEQQGPRLEQGLRE LWDSVLRASCLLPELLSALHRLVGLQAALWLSADRLGDLALLLETLNGSQSGASKDLLLL LKTWSPPAEELDAPLTLQDAQGLKDVLLTAFAYRQGLQELITGNPDKALSSLHEAASGLC PRPVLVQVYTALGSCHRKMGNPQRALLYLVAALKEGSAWGPPLLEASRLYQQLGDTTAEL ESLELLVEALNVPCSSKAPQFLIEVELLLPPPDLASPLHCGTQSQTKHILASRCLQTGRA GDAAEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDALTLCEEL LSRTSSLLPKMSRLWEDARKGTKELPYCPLWVSATHLLQGQAWVQLGAQKVAISEFSRCL ELLFRATPEEKEQGAAFNCEQGCKSDAALQQLRAAALISRGLEWVASGQDTKALQDFLLS VQMCPGNRDTYFHLLQTLKRLDRRDEATALWWRLEAQTKGSHEDALWSLPLYLESYLSWI RPSDRDAFLEEFRTSLPKSCDL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-c, adbSNP:10972303
complement(39..40)-, adbSNP:373894692
complement(40..41)-, tdbSNP:16935545
complement(101)-t, cdbSNP:10972302
complement(145)-t, cdbSNP:376750755
complement(443)-g, adbSNP:376115549
complement(453)-g, cdbSNP:375136403
complement(512)-t, cdbSNP:35984312
complement(547)-t, cdbSNP:186641344
complement(569)-t, cdbSNP:200677800
complement(578)-dbSNP:
complement(578)-c, adbSNP:199508085
complement(618)-g, cdbSNP:138331241
complement(682)-dbSNP:
complement(682)-t, g, cdbSNP:34821298
complement(730)-g, adbSNP:115131067
complement(785)-t, cdbSNP:372854981
805+dbSNP:
805+g, tdbSNP:121434425
complement(867)-g, cdbSNP:199754122
complement(891)-t, cdbSNP:200278002
complement(913)-g, adbSNP:201153812
complement(937)-g, adbSNP:368705880
complement(940)-t, adbSNP:202114813
complement(950)-g, cdbSNP:200074432
complement(955)-g, adbSNP:200926249
complement(956)-t, cdbSNP:201099560
complement(970)-t, cdbSNP:140534765
complement(971)-g, adbSNP:372437551
complement(1075)-dbSNP:
complement(1075)-g, adbSNP:370461759
complement(1127)-g, adbSNP:375754266
complement(1132)-g, adbSNP:61757385
complement(1161)-dbSNP:
complement(1161)-t, cdbSNP:143230416
complement(1197)-t, cdbSNP:148910563
complement(1214)-g, adbSNP:201438531
complement(1221)-g, adbSNP:199736443
complement(1231)-t, gdbSNP:145613634
1239+c, tdbSNP:1043957
complement(1253)-g, adbSNP:376825957
complement(1262)-t, cdbSNP:372234656
complement(1279)-dbSNP:
complement(1279)-g, adbSNP:149721361
complement(1290)-t, cdbSNP:200673434
complement(1301)-g, adbSNP:368277925
complement(1373)-t, cdbSNP:386545051
complement(1373)-g, adbSNP:17880082
complement(1382)-g, adbSNP:2237857
complement(1389..1390)-, cdbSNP:34504701
complement(1397)-c, adbSNP:61757386
complement(1409)-g, adbSNP:375601834
complement(1419)-dbSNP:
complement(1419)-g, adbSNP:370002843
complement(1445)-g, adbSNP:147594292
complement(1448..1449)-, gdbSNP:34100177
complement(1448)-g, adbSNP:202152417
complement(1449)-g, cdbSNP:145092954
complement(1476)-t, cdbSNP:375991144
complement(1480)-t, cdbSNP:4986940
complement(1480)-t, cdbSNP:386597009
complement(1508)-t, cdbSNP:372808885
complement(1513)-t, cdbSNP:369622138
1558+c, tdbSNP:121434426
complement(1562)-g, adbSNP:112854819
complement(1578)-dbSNP:
complement(1578)-g, adbSNP:376623996
complement(1625)-g, adbSNP:4986939
complement(1648)-dbSNP:
complement(1648)-g, cdbSNP:375757497
complement(1649)-g, cdbSNP:141147618
complement(1650)-g, cdbSNP:201041980
1675..1684+, gaggtgttttdbSNP:397507559
complement(1714)-t, cdbSNP:371171892
complement(1725)-t, cdbSNP:371809395
complement(1780)-g, adbSNP:17881054
complement(1780)-g, adbSNP:386545089
complement(1789)-g, adbSNP:183777537
complement(1820)-t, cdbSNP:191508370
complement(1824)-c, adbSNP:200456325
complement(1859)-t, adbSNP:148808709
complement(1914)-g, adbSNP:144369518
complement(1945)-dbSNP:
complement(1945)-g, adbSNP:201884798
complement(1946)-t, cdbSNP:77152961
complement(1954)-g, adbSNP:375682263
complement(1975)-dbSNP:
complement(1975)-t, cdbSNP:377131596
complement(2011)-t, cdbSNP:373151602
complement(2012)-g, adbSNP:138395184
complement(2013)-t, cdbSNP:373411028
complement(2017)-g, adbSNP:369652577
2030+a, gdbSNP:17885240
complement(2037)-g, adbSNP:201422773
complement(2038)-t, cdbSNP:199833626
2130+dbSNP:
2130+c, tdbSNP:45537335
complement(2181)-g, cdbSNP:138855718
complement(2210)-c, adbSNP:200466062
2286..2295+dbSNP:
2286..2295+, ctggatccgtdbSNP:397507560
complement(2293)-g, adbSNP:368098479
complement(2294)-t, cdbSNP:374723194
complement(2297)-t, gdbSNP:370950631
complement(2300)-t, cdbSNP:17878854
complement(2300)-g, adbSNP:386544985
complement(2333)-g, adbSNP:150203467
complement(2381)-g, adbSNP:377305067
complement(2382)-g, adbSNP:374590435
complement(2400)-t, cdbSNP:56405035
complement(2410)-g, adbSNP:148311161
complement(2444)-, cdbSNP:35057847
complement(2527)-g, cdbSNP:190050556
complement(2574)-g, adbSNP:185360895
complement(2612)-t, cdbSNP:386544970
complement(2612)-g, adbSNP:17878564
Gene SymbolFANCG
Gene SynonymFAG; XRCC9
Chromosome9
Locus Map9p13
Title Fanconi anaemia in black South African patients heterozygous for the FANCG c.637-643delTACCGCC founder mutation .
Author Wainstein T, Kerr R, Mitchell CL, Madaree S, Essop FB, Vorster E, Wainwright R, Poole J and Krause A.
Journal S. Afr. Med. J. 103 (12 SUPPL 1), 970-973 (2013)
Title FANCA and FANCG are the major Fanconi anemia genes in the Korean population .
Author Park J, Chung NG, Chae H, Kim M, Lee S, Kim Y, Lee JW, Cho B, Jeong
Journal Clin. Genet. 84 (3), 271-275 (2013)
Title Areca nut induces miR-23a and inhibits repair of DNA double-strand breaks by targeting FANCG .
Author Tsai YS, Lin CS, Chiang SL, Lee CH, Lee KW and Ko YC.
Journal Toxicol. Sci. 123 (2), 480-490 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Fanconi anemia proteins FANCA, FANCC, and FANCG/XRCC9 interact in a functional nuclear complex .
Author Garcia-Higuera I, Kuang Y, Naf D, Wasik J and D'Andrea AD.
Journal Mol. Cell. Biol. 19 (7), 4866-4873 (1999)
Title The Fanconi anaemia group G gene FANCG is identical with XRCC9 .
Author de Winter JP, Waisfisz Q, Rooimans MA, van Berkel CG, Bosnoyan-Collins L, Alon N, Carreau M, Bender O, Demuth I, Schindler D, Pronk JC, Arwert F, Hoehn H, Digweed M, Buchwald M and Joenje H.
Journal Nat. Genet. 20 (3), 281-283 (1998)
Title Evidence for at least eight Fanconi anemia genes .
Author Joenje H, Oostra AB, Wijker M, di Summa FM, van Berkel CG, Rooimans MA, Ebell W, van Weel M, Pronk JC, Buchwald M and Arwert F.
Journal Am. J. Hum. Genet. 61 (4), 940-944 (1997)
Title The human XRCC9 gene corrects chromosomal instability and mutagen sensitivities in CHO UV40 cells .
Author Liu N, Lamerdin JE, Tucker JD, Zhou ZQ, Walter CA, Albala JS, Busch
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (17), 9232-9237 (1997)
Title Esophageal Atresia/Tracheoesophageal Fistula Overview .
Author Scott,D.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Fanconi Anemia .
Author Alter,B.P. and Kupfer,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.