• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAB7A, member RAS oncogene family (RAB7A), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25792 Homo sapiens RAB7A, member RAS oncogene family (RAB7A), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25792C Homo sapiens RAB7A, member RAS oncogene family (RAB7A), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_004637.5, 40807361
Length 624 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens RAB7A, member RAS oncogene family (RAB7A), mRNA.
Product ras-related protein Rab-7a
Comment

Summary: RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. [provided by RefSeq, Jul 2008].

RefSeq NP_004628.4
CDS 233..856
Misc Feature(1)227..229
Misc Feature(2)227..229
Misc Feature(3)245..853
Misc Feature(4)245..853
Misc Feature(5)257..769
Misc Feature(6)257..262
Misc Feature(7)275..298
Misc Feature(8)order(281..301,329..331,335..337,350..352,428..430,
Misc Feature(9)order(281..283,356..358,362..367,419..421,431..433,
Misc Feature(10)order(299..334,338..349)
Misc Feature(11)order(329..331,344..370)
Misc Feature(12)341..367
Misc Feature(13)order(344..346,356..379,398..400,404..406)
Misc Feature(14)350..352
Misc Feature(15)order(353..355,359..367,410..412,416..418,437..442,
Misc Feature(16)353..367
Misc Feature(17)404..418
Misc Feature(18)419..430
Misc Feature(19)order(428..430,434..466)
Misc Feature(20)437..454
Misc Feature(21)446..448
Misc Feature(22)461..475
Misc Feature(23)488..505
Misc Feature(24)581..598
Misc Feature(25)605..616
Misc Feature(26)695..703
Misc Feature(27)743..769
Misc Feature(28)779..781
Misc Feature(29)845..847
Misc Feature(30)851..853
Exon (1)1..224
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Exon (2)225..285
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Exon (3)286..412
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Exon (4)413..631
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Exon (5)632..760
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Exon (6)761..2232
Gene:RAB7A
Gene Synonym:PRO2706; RAB7
Translation MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
99+dbSNP:
99+g, tdbSNP:112026138
118+c, tdbSNP:374777610
136+c, gdbSNP:141622970
204+g, tdbSNP:112000804
224+g, tdbSNP:11549760
252+a, tdbSNP:11549752
253+a, gdbSNP:140857794
263+c, gdbSNP:150089960
289+dbSNP:
289+c, tdbSNP:373510884
319+a, gdbSNP:145441548
321+a, gdbSNP:201407628
326+a, gdbSNP:11549759
410+c, tdbSNP:11549755
415+dbSNP:
415+a, cdbSNP:376642691
434+a, gdbSNP:11549758
445+a, gdbSNP:140299645
451+c, tdbSNP:4548
460+c, tdbSNP:11549757
509+c, gdbSNP:11549756
532+c, tdbSNP:138982701
570+a, gdbSNP:142136407
617+c, tdbSNP:121909078
635+dbSNP:
635+a, gdbSNP:368804888
653+g, tdbSNP:201399896
655+c, gdbSNP:61758751
703+c, gdbSNP:121909081
714+a, cdbSNP:121909080
716+a, gdbSNP:121909079
721+c, gdbSNP:200290674
727+a, gdbSNP:146566121
735+c, tdbSNP:141978327
738+c, tdbSNP:375630134
743+a, cdbSNP:1802891
765+dbSNP:
765+c, tdbSNP:142747565
770+a, gdbSNP:186247059
776+a, cdbSNP:140685176
781+c, tdbSNP:192418864
784+c, tdbSNP:143140848
800+a, gdbSNP:147480945
835+a, gdbSNP:61748098
899+a, gdbSNP:199811322
905+c, tdbSNP:373308557
939+c, tdbSNP:376932040
complement(1019..1020)-, tgdbSNP:3830294
1019+g, tdbSNP:182521602
1024..1037+, cacacacacacacgdbSNP:146444984
1037+a, gdbSNP:3206306
1038..1039+, cadbSNP:139417205
1045+a, gdbSNP:11549750
1057+c, tdbSNP:138714412
1062+a, gdbSNP:16851333
complement(1085)-t, cdbSNP:147244704
1120+a, cdbSNP:114778883
1212..1213+, gadbSNP:201899446
1266+a, tdbSNP:11549751
1427+a, tdbSNP:10222
1530+a, gdbSNP:1065349
1625+a, gdbSNP:115008416
1676+a, gdbSNP:369256306
1719+c, gdbSNP:59753334
1846+, tdbSNP:371200521
complement(1853)-g, adbSNP:3755593
1877+c, tdbSNP:373116095
1882+a, gdbSNP:376185459
1935+c, tdbSNP:141066124
1997+c, tdbSNP:192329045
2033+a, g, tdbSNP:144914469
2108..2109+, cdbSNP:34564209
2110+a, gdbSNP:377543858
2141..2142+, cdbSNP:34629369
2157+a, gdbSNP:182528613
2162+c, tdbSNP:1050006
2191+a, gdbSNP:1050012
2215+c, tdbSNP:147938224
Gene SymbolRAB7A
Gene SynonymPRO2706; RAB7
Chromosome3
Locus Map3q21.3
Title A novel RAB7 mutation in a Chinese family with Charcot-Marie-Tooth type 2B disease .
Author Wang,X., Han,C., Liu,W., Wang,P. and Zhang,X.
Journal Gene 534 (2), 431-434 (2014)
Title Rab family proteins regulate the endosomal trafficking and function of RGS4 .
Author Bastin G and Heximer SP.
Journal J. Biol. Chem. 288 (30), 21836-21849 (2013)
Title Regulation of hepatitis B virus infection by Rab5, Rab7, and the endolysosomal compartment .
Author Macovei A, Petrareanu C, Lazar C, Florian P and Branza-Nichita N.
Journal J. Virol. 87 (11), 6415-6427 (2013)
Title The TBC/RabGAP Armus coordinates Rac1 and Rab7 functions during autophagy .
Author Carroll B, Mohd-Naim N, Maximiano F, Frasa MA, McCormack J, Finelli M, Thoresen SB, Perdios L, Daigaku R, Francis RE, Futter C, Dikic I and Braga VM.
Journal Dev. Cell 25 (1), 15-28 (2013)
Title Molecular cloning and expression analysis of the human Rab7 GTP-ase complementary deoxyribonucleic acid .
Author Vitelli R, Chiariello M, Lattero D, Bruni CB and Bucci C.
Journal Biochem. Biophys. Res. Commun. 229 (3), 887-890 (1996)
Title Rab4 and Rab7 define distinct nonoverlapping endosomal compartments .
Author Bottger G, Nagelkerken B and van der Sluijs P.
Journal J. Biol. Chem. 271 (46), 29191-29197 (1996)
Title Kinetics of interaction of Rab5 and Rab7 with nucleotides and magnesium ions .
Author Simon I, Zerial M and Goody RS.
Journal J. Biol. Chem. 271 (34), 20470-20478 (1996)
Title Charcot-Marie-Tooth Hereditary Neuropathy Overview .
Author Bird,T.D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Charcot-Marie-Tooth Neuropathy Type 2 .
Author Bird,T.D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Localization of low molecular weight GTP binding proteins to exocytic and endocytic compartments .
Author Chavrier P, Parton RG, Hauri HP, Simons K and Zerial M.
Journal Cell 62 (2), 317-329 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.