• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA.


RefSeq Accession Definition Services Price Order
NM_004654 Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA. ORF Sequence $3450.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004654.3, 74319832
Length 10048 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA.
Product probable ubiquitin carboxyl-terminal hydrolase FAF-Y
Comment

Summary: This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. [provided by RefSeq, Mar 2009].

RefSeq NP_004645.2
CDS 946..8613
Misc Feature(1)709..711
Misc Feature(2)5614..6816
Misc Feature(3)5614..6816
Misc Feature(4)5614..6810
Misc Feature(5)order(5632..5634,5647..5649,6586..6588,6655..6657)
Exon (1)1..825
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (2)826..885
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (3)886..1041
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (4)1042..1190
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (5)1191..1270
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (6)1271..1383
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (7)1384..1602
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (8)1603..1718
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (9)1719..1970
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (10)1971..2109
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (11)2110..2262
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (12)2263..2367
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (13)2368..2574
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (14)2575..2711
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (15)2712..2845
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (16)2846..2933
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (17)2934..3276
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (18)3277..3372
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (19)3373..3584
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (20)3585..3825
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (21)3826..3975
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (22)3976..4096
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (23)4097..4227
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (24)4228..4506
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (25)4507..4632
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (26)4633..4758
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (27)4759..4928
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (28)4929..5037
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (29)5038..5184
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (30)5185..5331
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (31)5332..5554
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (32)5555..5775
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (33)5776..5966
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (34)5967..6140
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (35)6141..6282
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (36)6283..7033
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (37)7034..7157
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (38)7158..7383
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (39)7384..7513
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (40)7514..7699
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (41)7700..7920
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (42)7921..8009
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (43)8010..8166
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (44)8167..8379
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (45)8380..8475
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (46)8476..10040
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Translation MTAITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQ HEDEEPAFPHTELANLDDMINRPRWVVPVLPKGELEVLLEAAIDLSVKGLDVKSEACQRF FRDGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALN PHCKFHIYNGTRPCELISSNAQLPEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHD RFFNGSALNIQIIAALIKPFGQCYEFLSQHTLKKYFIPVIEIVPHLLENLTDEELKKEAK NEAKNDALSMIIKSLKNLASRISGQDETIKNLEIFRLKMILRLLQISSFNGKMNALNEIN KVISSVSYYTHRHSNPEEEEWLTAERMAEWIQQNNILSIVLQDSLHQPQYVEKLEKILRF VIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPGQLDHLFDCFKASWTNA SKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAQSDDVPVDIMDLALSAHIKILDYS CSQDRDAQKIQWIDHFIEELRTNDKWVIPALKQIREICSLFGEASQNLSQTQRSPHIFYR HDLINQLQQNHALVTLVAENLATYMNSIRLYAGDHEDYDPQTVRLGSRYSHVQEVQERLN FLRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDF FESNVLQLDPSLLTENGMKCFERFFKAVNCRERKLIAKRRSYMMDDLELIGLDYLWRVVI QSSDEIANRAIDLLKEIYTNLGPRLKANQVVIHEDFIQSCFDRLKASYDTLCVFDGDKNS INCARQEAIRMVRVLTVIKEYINECDSDYHKERMILPMSRAFRGKHLSLIVRFPNQGRQV DELDIWSHTNDTIGSVRRCIVNRIKANVAHKKIELFVGGELIDSEDDRKLIGQLNLKDKS LITAKLTQINFNMPSSPDSSSDSSTASPGNHRNHYNDGPNLEVESCLPGVIMSVHPRYIS FLWQVADLGSNLNMPPLRDGARVLMKLMPPDRTAVEKLRAVCLDHAKLGEGKLSPPLDSL FFGPSASQVLYLTEVVYALLMPAGVPLTDGSSDFQVHFLKSGGLPLVLSMLIRNNFLPNT DMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVDGTDPITQINQVTHDQAVVLQ SALQSIPNPSSECVLRNESILLAQEISNEASRYMPDICVIRAIQKIIWASACGALGLVFS PNEEITKIYQMTTNGSNKLEVEDEQVCCEALEVMTLCFALLPTALDALSKEKAWQTFIID LLLHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTAREKGKYSGDYFTL LRHLLNYAYNGNINIPNAEVLLVSEIDWLKRIRDNVKNTGETGVEEPILEGHLGVTKELL AFQTSEKKYHFGCEKGGANLIKELIDDFIFPASKVYLQYLRSGELPAEQAIPVCSSPVTI NAGFELLVALAIGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFVG LKNAGATCYMNSVIQQLYMIPSIRNSILAIEGTGSDLHDDMFGDEKQDSESNVDPRDDVF GYPHQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASQLQYYVPRGFWKQFRLWGEPV NLREQHDALEFFNSLVDSLDEALKALGHPAILSKVLGGSFADQKICQGCPHRYECEESFT TLNVDIRNHQNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLK RFDYDWERECAIKFNDYFEFPRELDMGPYTVAGVANLERDNVNSENELIEQKEQSDNETA GGTKYRLVGVLVHSGQASGGHYYSYIIQRNGKDDQTDHWYKFDDGDVTECKMDDDEEMKN QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYEQMDMIDEDDEMIRYISELTIARPH QIIMSPAIERSVRKQNVKFMHNRLQYSLEYFQFVKKLLTCNGVYLNPAPGQDYLLPEAEE ITMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCVLLRHSKNVRFWFTHNVLFNVSNR FSEYLLECPSAEVRGAFAKLIVFIAHFSLQDGSCPSPFASPGPSSQACDNLSLSDHLLRA TLNLLRREVSEHGHHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVSLDEGPGPPIK YQYAELGKLYSVVSQLIRCCNVSSTMQSSINGNPPLPNPFGDLNLSQPIMPIQQNVLDIL FVRTSYVKKIIEDCSNSEDTIKLLRFCSWENPQFSSTVLSELLWQVAYSYTYELRPYLDL LFQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCP VAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLER SHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYT GPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
558+c, tdbSNP:2032594
1127+dbSNP:
1127+a, gdbSNP:112373496
1140+g, tdbSNP:7067496
1360+dbSNP:
1360+a, gdbSNP:199703654
1362+g, tdbSNP:200439481
1462+dbSNP:
1462+c, gdbSNP:201485639
1576+c, tdbSNP:2032596
1845+dbSNP:
1845+g, tdbSNP:112694338
2330+dbSNP:
2330+c, gdbSNP:3212291
2342+a, tdbSNP:3212292
2358+c, tdbSNP:2032599
2429+dbSNP:
2429+c, tdbSNP:201646512
2747+dbSNP:
2747+a, gdbSNP:199859662
3573+dbSNP:
3573+a, cdbSNP:2032600
3606+dbSNP:
3606+c, tdbSNP:34601266
4048+dbSNP:
4048+c, tdbSNP:20319
4051+c, tdbSNP:200142685
4123+dbSNP:
4123+a, gdbSNP:20320
4238+dbSNP:
4238+c, tdbSNP:202095134
4343+a, gdbSNP:11799215
4581+dbSNP:
4581+a, gdbSNP:20321
4623+a, gdbSNP:202177274
4937+dbSNP:
4937+a, gdbSNP:201974640
5436+dbSNP:
5436+c, tdbSNP:2032605
5692+dbSNP:
5692+a, gdbSNP:201309811
5993+dbSNP:
5993+a, gdbSNP:201449006
6058+g, tdbSNP:2032606
6817+dbSNP:
6817+a, gdbSNP:199530143
7272+dbSNP:
7272+c, tdbSNP:2032602
7329+c, tdbSNP:200311491
7726+dbSNP:
7726+a, gdbSNP:201556186
7859+a, gdbSNP:201749128
8076+dbSNP:
8076+a, gdbSNP:9341284
8525+dbSNP:
8525+c, tdbSNP:113753499
8527+a, cdbSNP:58915173
9985+g, tdbSNP:199904650
Gene SymbolUSP9Y
Gene SynonymDFFRY; SPGFY2
ChromosomeY
Locus MapYq11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004654 Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA. Full Length Quote
ORF Sequence $3450.60
Title Spermatogenesis in a man with complete deletion of USP9Y .
Author Luddi,A., Margollicci,M., Gambera,L., Serafini,F., Cioni,M., De Leo,V., Balestri,P. and Piomboni,P.
Journal N. Engl. J. Med. 360 (9), 881-885 (2009)
Title Genetic variants of Y chromosome are associated with a protective lipid profile in black men .
Author Russo,P., Siani,A., Miller,M.A., Karanam,S., Esposito,T., Gianfrancesco,F., Barba,G., Lauria,F., Strazzullo,P. and Cappuccio,F.P.
Journal Arterioscler. Thromb. Vasc. Biol. 28 (8), 1569-1574 (2008)
Title A rare Y chromosome missense mutation in exon 25 of human USP9Y revealed by pyrosequencing .
Author Sims,L.M. and Ballantyne,J.
Journal Biochem. Genet. 46 (3-4), 154-161 (2008)
Title AZF gene expression analysis in peripheral leukocytes and testicular cells from idiopathic infertility .
Author Song,N.H., Yin,C.J., Zhang,W., Zhuo,Z.M., Ding,G.X., Zhang,J., Hua,L.X. and Wu,H.F.
Journal Arch. Androl. 53 (6), 317-324 (2007)
Title Natural transmission of USP9Y gene mutations: a new perspective on the role of AZFa genes in male fertility .
Author Krausz,C., Degl'Innocenti,S., Nuti,F., Morelli,A., Felici,F., Sansone,M., Varriale,G. and Forti,G.
Journal Hum. Mol. Genet. 15 (18), 2673-2681 (2006)
Title An azoospermic man with a de novo point mutation in the Y-chromosomal gene USP9Y .
Author Sun,C., Skaletsky,H., Birren,B., Devon,K., Tang,Z., Silber,S., Oates,R. and Page,D.C.
Journal Nat. Genet. 23 (4), 429-432 (1999)
Title Characterisation of the coding sequence and fine mapping of the human DFFRY gene and comparative expression analysis and mapping to the Sxrb interval of the mouse Y chromosome of the Dffry gene .
Author Brown,G.M., Furlong,R.A., Sargent,C.A., Erickson,R.P., Longepied,G., Mitchell,M., Jones,M.H., Hargreave,T.B., Cooke,H.J. and Affara,N.A.
Journal Hum. Mol. Genet. 7 (1), 97-107 (1998)
Title Deubiquitinating enzymes: a new class of biological regulators .
Author D'Andrea,A. and Pellman,D.
Journal Crit. Rev. Biochem. Mol. Biol. 33 (5), 337-352 (1998)
Title Functional coherence of the human Y chromosome .
Author Lahn,B.T. and Page,D.C.
Journal Science 278 (5338), 675-680 (1997)
Title The Drosophila developmental gene fat facets has a human homologue in Xp11.4 which escapes X-inactivation and has related sequences on Yq11.2 .
Author Jones,M.H., Furlong,R.A., Burkin,H., Chalmers,I.J., Brown,G.M., Khwaja,O. and Affara,N.A.
Journal Hum. Mol. Genet. 5 (11), 1695-1701 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878