• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18493 Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA. pcDNA3.1+-DYK On-demand $3749.00 35
OHu18493C Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA. Customized vector On-demand $3749.00 35

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004654.3, 74319832
Length 7668 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA.
Product probable ubiquitin carboxyl-terminal hydrolase FAF-Y
Comment

Summary: This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. [provided by RefSeq, Mar 2009].

RefSeq NP_004645.2
CDS 946..8613
Misc Feature(1)709..711
Misc Feature(2)5614..6825
Misc Feature(3)5614..6825
Misc Feature(4)5617..6810
Misc Feature(5)order(5632..5634,5647..5649,6586..6588,6655..6657)
Exon (1)1..825
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (2)826..885
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (3)886..1041
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (4)1042..1190
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (5)1191..1270
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (6)1271..1383
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (7)1384..1602
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (8)1603..1718
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (9)1719..1970
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (10)1971..2109
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (11)2110..2262
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (12)2263..2367
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (13)2368..2574
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (14)2575..2711
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (15)2712..2845
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (16)2846..2933
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (17)2934..3276
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (18)3277..3372
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (19)3373..3584
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (20)3585..3825
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (21)3826..3975
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (22)3976..4096
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (23)4097..4227
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (24)4228..4506
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (25)4507..4632
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (26)4633..4758
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (27)4759..4928
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (28)4929..5037
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (29)5038..5184
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (30)5185..5331
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (31)5332..5554
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (32)5555..5775
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (33)5776..5966
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (34)5967..6140
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (35)6141..6282
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (36)6283..7033
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (37)7034..7157
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (38)7158..7383
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (39)7384..7513
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (40)7514..7699
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (41)7700..7920
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (42)7921..8009
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (43)8010..8166
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (44)8167..8379
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (45)8380..8475
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Exon (46)8476..10040
Gene:USP9Y
Gene Synonym:DFFRY; SPGFY2
Translation MTAITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQ HEDEEPAFPHTELANLDDMINRPRWVVPVLPKGELEVLLEAAIDLSVKGLDVKSEACQRF FRDGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALN PHCKFHIYNGTRPCELISSNAQLPEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHD RFFNGSALNIQIIAALIKPFGQCYEFLSQHTLKKYFIPVIEIVPHLLENLTDEELKKEAK NEAKNDALSMIIKSLKNLASRISGQDETIKNLEIFRLKMILRLLQISSFNGKMNALNEIN KVISSVSYYTHRHSNPEEEEWLTAERMAEWIQQNNILSIVLQDSLHQPQYVEKLEKILRF VIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPGQLDHLFDCFKASWTNA SKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAQSDDVPVDIMDLALSAHIKILDYS CSQDRDAQKIQWIDHFIEELRTNDKWVIPALKQIREICSLFGEASQNLSQTQRSPHIFYR HDLINQLQQNHALVTLVAENLATYMNSIRLYAGDHEDYDPQTVRLGSRYSHVQEVQERLN FLRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDF FESNVLQLDPSLLTENGMKCFERFFKAVNCRERKLIAKRRSYMMDDLELIGLDYLWRVVI QSSDEIANRAIDLLKEIYTNLGPRLKANQVVIHEDFIQSCFDRLKASYDTLCVFDGDKNS INCARQEAIRMVRVLTVIKEYINECDSDYHKERMILPMSRAFRGKHLSLIVRFPNQGRQV DELDIWSHTNDTIGSVRRCIVNRIKANVAHKKIELFVGGELIDSEDDRKLIGQLNLKDKS LITAKLTQINFNMPSSPDSSSDSSTASPGNHRNHYNDGPNLEVESCLPGVIMSVHPRYIS FLWQVADLGSNLNMPPLRDGARVLMKLMPPDRTAVEKLRAVCLDHAKLGEGKLSPPLDSL FFGPSASQVLYLTEVVYALLMPAGVPLTDGSSDFQVHFLKSGGLPLVLSMLIRNNFLPNT DMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVDGTDPITQINQVTHDQAVVLQ SALQSIPNPSSECVLRNESILLAQEISNEASRYMPDICVIRAIQKIIWASACGALGLVFS PNEEITKIYQMTTNGSNKLEVEDEQVCCEALEVMTLCFALLPTALDALSKEKAWQTFIID LLLHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTAREKGKYSGDYFTL LRHLLNYAYNGNINIPNAEVLLVSEIDWLKRIRDNVKNTGETGVEEPILEGHLGVTKELL AFQTSEKKYHFGCEKGGANLIKELIDDFIFPASKVYLQYLRSGELPAEQAIPVCSSPVTI NAGFELLVALAIGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFVG LKNAGATCYMNSVIQQLYMIPSIRNSILAIEGTGSDLHDDMFGDEKQDSESNVDPRDDVF GYPHQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASQLQYYVPRGFWKQFRLWGEPV NLREQHDALEFFNSLVDSLDEALKALGHPAILSKVLGGSFADQKICQGCPHRYECEESFT TLNVDIRNHQNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLK RFDYDWERECAIKFNDYFEFPRELDMGPYTVAGVANLERDNVNSENELIEQKEQSDNETA GGTKYRLVGVLVHSGQASGGHYYSYIIQRNGKDDQTDHWYKFDDGDVTECKMDDDEEMKN QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYEQMDMIDEDDEMIRYISELTIARPH QIIMSPAIERSVRKQNVKFMHNRLQYSLEYFQFVKKLLTCNGVYLNPAPGQDYLLPEAEE ITMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCVLLRHSKNVRFWFTHNVLFNVSNR FSEYLLECPSAEVRGAFAKLIVFIAHFSLQDGSCPSPFASPGPSSQACDNLSLSDHLLRA TLNLLRREVSEHGHHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVSLDEGPGPPIK YQYAELGKLYSVVSQLIRCCNVSSTMQSSINGNPPLPNPFGDLNLSQPIMPIQQNVLDIL FVRTSYVKKIIEDCSNSEDTIKLLRFCSWENPQFSSTVLSELLWQVAYSYTYELRPYLDL LFQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCP VAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLER SHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYT GPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
558+c, tdbSNP:2032594
1082+dbSNP:
1082+a, cdbSNP:373528763
1124+a, cdbSNP:374157580
1127+a, gdbSNP:112373496
1140+g, tdbSNP:7067496
1316+dbSNP:
1316+g, tdbSNP:370945889
1360+a, gdbSNP:199703654
1362+g, tdbSNP:200439481
1462+dbSNP:
1462+c, gdbSNP:201485639
1520+a, gdbSNP:367569859
1523+c, gdbSNP:370889214
1576+c, tdbSNP:2032596
1660+dbSNP:
1660+c, tdbSNP:368342388
1845+dbSNP:
1845+g, tdbSNP:112694338
2074+dbSNP:
2074+c, gdbSNP:372193615
2330+dbSNP:
2330+c, gdbSNP:3212291
2342+a, tdbSNP:3212292
2358+c, tdbSNP:2032599
2426+dbSNP:
2426+a, gdbSNP:369774788
2429+c, tdbSNP:201646512
2496+a, gdbSNP:377405462
2671+dbSNP:
2671+c, gdbSNP:374905950
2695+a, gdbSNP:369637594
2747+dbSNP:
2747+a, gdbSNP:199859662
3562+dbSNP:
3562+a, cdbSNP:371530213
3573+a, cdbSNP:2032600
3606+dbSNP:
3606+c, tdbSNP:34601266
3763+a, gdbSNP:376623068
3920+dbSNP:
3920+a, gdbSNP:368029195
4008+dbSNP:
4008+c, tdbSNP:375680833
4048+c, tdbSNP:20319
4051+c, tdbSNP:200142685
4123+dbSNP:
4123+a, gdbSNP:20320
4140+a, gdbSNP:376357113
4238+dbSNP:
4238+c, tdbSNP:202095134
4343+a, gdbSNP:11799215
4581+dbSNP:
4581+a, gdbSNP:20321
4584+c, tdbSNP:371502065
4623+a, gdbSNP:202177274
4645+dbSNP:
4645+a, cdbSNP:369585016
4767+dbSNP:
4767+c, tdbSNP:373999877
4937+dbSNP:
4937+a, gdbSNP:201974640
5173+dbSNP:
5173+a, gdbSNP:377328107
5286+dbSNP:
5286+a, gdbSNP:377416158
5289+a, gdbSNP:370736418
5436+dbSNP:
5436+c, tdbSNP:2032605
5470+a, gdbSNP:375636378
5692+dbSNP:
5692+a, gdbSNP:201309811
5719+a, gdbSNP:367672412
5812+dbSNP:
5812+a, cdbSNP:371763115
5993+dbSNP:
5993+a, gdbSNP:201449006
6051+a, tdbSNP:369882658
6058+g, tdbSNP:2032606
6219+dbSNP:
6219+g, tdbSNP:376361721
6323+dbSNP:
6323+a, gdbSNP:377466381
6579+a, cdbSNP:368795914
6629+a, cdbSNP:373906119
6683+a, gdbSNP:376458211
6757+c, tdbSNP:370633830
6817+a, gdbSNP:199530143
6864+a, gdbSNP:374339283
7138+dbSNP:
7138+c, tdbSNP:377271136
7184+dbSNP:
7184+a, gdbSNP:371137824
7272+c, tdbSNP:2032602
7322+a, gdbSNP:374524962
7329+c, tdbSNP:200311491
7697+dbSNP:
7697+a, gdbSNP:374174704
7726+dbSNP:
7726+a, gdbSNP:201556186
7859+a, gdbSNP:201749128
8061+dbSNP:
8061+g, tdbSNP:375579274
8076+a, gdbSNP:9341284
8272+dbSNP:
8272+c, tdbSNP:377207666
8525+dbSNP:
8525+c, tdbSNP:113753499
8527+a, cdbSNP:58915173
8662+a, gdbSNP:375772893
9939+c, tdbSNP:375206568
9985+g, tdbSNP:199904650
Gene SymbolUSP9Y
Gene SynonymDFFRY; SPGFY2
ChromosomeY
Locus MapYq11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004654 Homo sapiens ubiquitin specific peptidase 9, Y-linked (USP9Y), mRNA. On-demand $3749.00 35
Title [Identification of a novel Y-SNP in the USP9Y gene and its impact on genotyping alleles of the M46 locus] .
Author Rebala K, Tsybovsky IS, Mikulich AI and Szczerkowska Z.
Journal Arch Med Sadowej Kryminol 62 (3), 165-170 (2012)
Title Spermatogenesis in a man with complete deletion of USP9Y .
Author Luddi A, Margollicci M, Gambera L, Serafini F, Cioni M, De Leo V, Balestri P and Piomboni P.
Journal N. Engl. J. Med. 360 (9), 881-885 (2009)
Title Genetic variants of Y chromosome are associated with a protective lipid profile in black men .
Author Russo P, Siani A, Miller MA, Karanam S, Esposito T, Gianfrancesco F, Barba G, Lauria F, Strazzullo P and Cappuccio FP.
Journal Arterioscler. Thromb. Vasc. Biol. 28 (8), 1569-1574 (2008)
Title A rare Y chromosome missense mutation in exon 25 of human USP9Y revealed by pyrosequencing .
Author Sims LM and Ballantyne J.
Journal Biochem. Genet. 46 (3-4), 154-161 (2008)
Title AZF gene expression analysis in peripheral leukocytes and testicular cells from idiopathic infertility .
Author Song NH, Yin CJ, Zhang W, Zhuo ZM, Ding GX, Zhang J, Hua LX and Wu HF.
Journal Arch. Androl. 53 (6), 317-324 (2007)
Title Characterisation of the coding sequence and fine mapping of the human DFFRY gene and comparative expression analysis and mapping to the Sxrb interval of the mouse Y chromosome of the Dffry gene .
Author Brown GM, Furlong RA, Sargent CA, Erickson RP, Longepied G, Mitchell M, Jones MH, Hargreave TB, Cooke HJ and Affara NA.
Journal Hum. Mol. Genet. 7 (1), 97-107 (1998)
Title Deubiquitinating enzymes: a new class of biological regulators .
Author D'Andrea A and Pellman D.
Journal Crit. Rev. Biochem. Mol. Biol. 33 (5), 337-352 (1998)
Title Functional coherence of the human Y chromosome .
Author Lahn BT and Page DC.
Journal Science 278 (5338), 675-680 (1997)
Title The Drosophila developmental gene fat facets has a human homologue in Xp11.4 which escapes X-inactivation and has related sequences on Yq11.2 .
Author Jones MH, Furlong RA, Burkin H, Chalmers IJ, Brown GM, Khwaja O and Affara NA.
Journal Hum. Mol. Genet. 5 (11), 1695-1701 (1996)
Title Y Chromosome Infertility .
Author Silber,S.J. and Disteche,C.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.