• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_004750 Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA. Full Lenth $528.96
ORF Sequence $368.01


RefSeq Version NM_004750.4, 260655997
Length 1824 bp
Structure linear
Update Date 11-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA.
Product cytokine receptor-like factor 1 precursor
Comment

Summary: This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq]. COMPLETENESS: complete on the 3' end.

RefSeq NP_004741.1
CDS 195..1463
Exon (1)1..309
Exon (2)1..309
Exon (3)310..591
Exon (4)592..721
Exon (5)722..891
Exon (6)892..1049
Exon (7)1050..1218
Exon (8)1219..1406
Exon (9)1407..1449
Exon (10)1450..1804
Translation MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPD VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP AR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
225..247+, caatccgcgcggcggccgccgccdbSNP:137853929
267..269+, ctgdbSNP:137853925
complement(269)-, agcdbSNP:34503316
complement(341)-t, cdbSNP:7259478
complement(360..361)-, gdbSNP:34603196
420+g, tdbSNP:137853143
complement(431)-g, adbSNP:2238647
436+a, gdbSNP:104894670
497+, cdbSNP:137853931
complement(505)-t, cdbSNP:117193413
607+c, tdbSNP:137853930
complement(641)-t, cdbSNP:114059820
complement(721)-t, cdbSNP:11672248
732+c, tdbSNP:137853926
complement(774)-g, adbSNP:117509603
1023+c, tdbSNP:137853145
1038..1039+, gtdbSNP:137853928
1046+g, tdbSNP:137853927
1129+a, gdbSNP:137853933
complement(1214)-g, cdbSNP:35459448
1296+a, tdbSNP:137853144
1315+g, tdbSNP:104894668
complement(1340)-g, adbSNP:17854326
1503+a, cdbSNP:1802330
complement(1599)-t, gdbSNP:74889954
complement(1614)-g, adbSNP:3202500
complement(1649)-g, adbSNP:1061404
complement(1745)-t, cdbSNP:80184203
Gene SymbolCRLF1
Gene SynonymCISS; CISS1; CLF; CLF-1; NR6; zcytor5
Chromosome19
Locus Map19p12
All Transcripts NM_004750
Title Cytokine receptor-like factor 1 is highly expressed in damaged human knee osteoarthritic cartilage and involved in osteoarthritis downstream of TGF-beta .
Author Tsuritani,K., Takeda,J., Sakagami,J., Ishii,A., Eriksson,T., Hara,T., Ishibashi,H., Koshihara,Y., Yamada,K. and Yoneda,Y.
Journal Calcif. Tissue Int. 86 (1), 47-57 (2010)
Title Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1 .
Author Crisponi,L., Crisponi,G., Meloni,A., Toliat,M.R., Nurnberg,G., Usala,G., Uda,M., Masala,M., Hohne,W., Becker,C., Marongiu,M., Chiappe,F., Kleta,R., Rauch,A., Wollnik,B., Strasser,F., Reese,T., Jakobs,C., Kurlemann,G., Cao,A., Nurnberg,P. and Rutsch,F.
Journal Am. J. Hum. Genet. 80 (5), 971-981 (2007)
Title Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes .
Author Dagoneau,N., Bellais,S., Blanchet,P., Sarda,P., Al-Gazali,L.I., Di Rocco,M., Huber,C., Djouadi,F., Le Goff,C., Munnich,A. and Cormier-Daire,V.
Journal Am. J. Hum. Genet. 80 (5), 966-970 (2007)
Title Signal peptide prediction based on analysis of experimentally verified cleavage sites .
Author Zhang,Z. and Henzel,W.J.
Journal Protein Sci. 13 (10), 2819-2824 (2004)
Title Characterizing the new transcription regulator protein p60TRP .
Author Heese,K., Yamada,T., Akatsu,H., Yamamoto,T., Kosaka,K., Nagai,Y. and Sawada,T.
Journal J. Cell. Biochem. 91 (5), 1030-1042 (2004)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title Cold-induced sweating syndrome is caused by mutations in the CRLF1 gene .
Author Knappskog,P.M., Majewski,J., Livneh,A., Nilsen,P.T., Bringsli,J.S., Ott,J. and Boman,H.
Journal Am. J. Hum. Genet. 72 (2), 375-383 (2003)
Title CLF associates with CLC to form a functional heteromeric ligand for the CNTF receptor complex .
Author Elson,G.C., Lelievre,E., Guillet,C., Chevalier,S., Plun-Favreau,H., Froger,J., Suard,I., de Coignac,A.B., Delneste,Y., Bonnefoy,J.Y., Gauchat,J.F. and Gascan,H.
Journal Nat. Neurosci. 3 (9), 867-872 (2000)
Title Cytokine-like factor-1, a novel soluble protein, shares homology with members of the cytokine type I receptor family .
Author Elson,G.C., Graber,P., Losberger,C., Herren,S., Gretener,D., Menoud,L.N., Wells,T.N., Kosco-Vilbois,M.H. and Gauchat,J.F.
Journal J. Immunol. 161 (3), 1371-1379 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878