• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA.


RefSeq Accession Definition Services Price Order
NM_004750 Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA. ORF Sequence $368.01
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004750.4, 260655997
Length 1824 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA.
Product cytokine receptor-like factor 1 precursor
Comment

Summary: This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq, Oct 2009].

RefSeq NP_004741.1
CDS 195..1463
Misc Feature(1)27..29
Misc Feature(2)597..848
Misc Feature(3)order(597..599,801..803,846..848)
Misc Feature(4)942..1208
Misc Feature(5)order(1101..1103,1170..1172)
Misc Feature(6)1173..1187
Misc Feature(7)order(1173..1178,1182..1187)
Exon (1)1..309
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (2)310..591
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (3)592..721
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (4)722..891
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (5)892..1049
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (6)1050..1218
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (7)1219..1406
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (8)1407..1449
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Exon (9)1450..1804
Gene:CRLF1
Gene Synonym:CISS; CISS1; CLF; CLF-1; NR6; zcytor5
Translation MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPD VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP AR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(24)-dbSNP:
complement(24)-g, adbSNP:141412226
225..247+, caatccgcgcggcggccgccgccdbSNP:137853929
complement(267..269)-, ctgdbSNP:137853925
complement(269..271)-, agcdbSNP:200332173
complement(269)-, agcdbSNP:34503316
complement(341)-dbSNP:
complement(341)-t, cdbSNP:7259478
complement(351)-t, cdbSNP:200728283
complement(360..361)-, gdbSNP:34603196
complement(366)-g, cdbSNP:151254980
complement(384)-t, cdbSNP:142326326
complement(407)-g, cdbSNP:201940100
complement(420)-t, gdbSNP:137853143
complement(431)-g, adbSNP:2238647
complement(436)-g, adbSNP:104894670
complement(443)-t, cdbSNP:146098226
complement(447)-g, adbSNP:202030926
complement(460)-t, cdbSNP:143326783
complement(463)-g, adbSNP:199855680
complement(494)-t, cdbSNP:201176844
complement(497)-, cdbSNP:137853931
complement(505)-t, cdbSNP:117193413
complement(536)-g, adbSNP:139923667
complement(550)-t, cdbSNP:146027258
complement(607)-dbSNP:
complement(607)-t, cdbSNP:137853930
complement(608)-g, adbSNP:199728865
complement(641)-t, cdbSNP:114059820
complement(655)-t, cdbSNP:189608159
complement(661)-g, adbSNP:150710034
complement(675)-t, cdbSNP:141162071
complement(721)-t, cdbSNP:11672248
complement(732)-dbSNP:
complement(732)-t, cdbSNP:137853926
complement(854)-g, cdbSNP:148208638
complement(855)-g, adbSNP:199625640
complement(860)-g, adbSNP:200226757
complement(861)-t, cdbSNP:145884498
complement(909)-dbSNP:
complement(909)-g, adbSNP:201795161
complement(955)-t, cdbSNP:142531140
complement(960)-g, adbSNP:139919292
complement(1014)-t, gdbSNP:147108114
complement(1016)-g, cdbSNP:149015379
complement(1023)-t, cdbSNP:137853145
complement(1038..1039)-, gtdbSNP:137853928
complement(1046)-t, gdbSNP:137853927
1051..1058+dbSNP:
1051..1058+, tggtggacdbSNP:367543004
complement(1067)-g, adbSNP:145872761
complement(1076)-g, cdbSNP:201135202
complement(1097)-g, cdbSNP:149763685
complement(1129)-g, adbSNP:137853933
complement(1214)-g, cdbSNP:35459448
complement(1286)-dbSNP:
complement(1286)-t, cdbSNP:201943206
complement(1293)-g, adbSNP:200022768
complement(1296)-t, adbSNP:137853144
complement(1315)-t, gdbSNP:104894668
complement(1340)-g, adbSNP:17854326
complement(1454)-dbSNP:
complement(1454)-g, adbSNP:140937454
complement(1474)-t, gdbSNP:140234226
complement(1503)-c, adbSNP:1802330
complement(1614)-g, adbSNP:3202500
complement(1649)-g, adbSNP:1061404
complement(1745)-t, cdbSNP:80184203
Gene SymbolCRLF1
Gene SynonymCISS; CISS1; CLF; CLF-1; NR6; zcytor5
Chromosome19
Locus Map19p12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004750 Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA. Full Length $528.96
ORF Sequence $368.01
Title Cytokine-like factor 1 gene expression is enriched in idiopathic pulmonary fibrosis and drives the accumulation of CD4+ T cells in murine lungs: evidence for an antifibrotic role in bleomycin injury .
Author Kass,D.J., Yu,G., Loh,K.S., Savir,A., Borczuk,A., Kahloon,R., Juan-Guardela,B., Deiuliis,G., Tedrow,J., Choi,J., Richards,T., Kaminski,N. and Greenberg,S.M.
Journal Am. J. Pathol. 180 (5), 1963-1978 (2012)
Title Differential secretion of the mutated protein is a major component affecting phenotypic severity in CRLF1-associated disorders .
Author Herholz,J., Meloni,A., Marongiu,M., Chiappe,F., Deiana,M., Herrero,C.R., Zampino,G., Hamamy,H., Zalloum,Y., Waaler,P.E., Crisponi,G., Crisponi,L. and Rutsch,F.
Journal Eur. J. Hum. Genet. 19 (5), 525-533 (2011)
Title Cytokine receptor-like factor 1 is highly expressed in damaged human knee osteoarthritic cartilage and involved in osteoarthritis downstream of TGF-beta .
Author Tsuritani,K., Takeda,J., Sakagami,J., Ishii,A., Eriksson,T., Hara,T., Ishibashi,H., Koshihara,Y., Yamada,K. and Yoneda,Y.
Journal Calcif. Tissue Int. 86 (1), 47-57 (2010)
Title Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1 .
Author Crisponi,L., Crisponi,G., Meloni,A., Toliat,M.R., Nurnberg,G., Usala,G., Uda,M., Masala,M., Hohne,W., Becker,C., Marongiu,M., Chiappe,F., Kleta,R., Rauch,A., Wollnik,B., Strasser,F., Reese,T., Jakobs,C., Kurlemann,G., Cao,A., Nurnberg,P. and Rutsch,F.
Journal Am. J. Hum. Genet. 80 (5), 971-981 (2007)
Title Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes .
Author Dagoneau,N., Bellais,S., Blanchet,P., Sarda,P., Al-Gazali,L.I., Di Rocco,M., Huber,C., Djouadi,F., Le Goff,C., Munnich,A. and Cormier-Daire,V.
Journal Am. J. Hum. Genet. 80 (5), 966-970 (2007)
Title Characterizing the new transcription regulator protein p60TRP .
Author Heese,K., Yamada,T., Akatsu,H., Yamamoto,T., Kosaka,K., Nagai,Y. and Sawada,T.
Journal J. Cell. Biochem. 91 (5), 1030-1042 (2004)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title Cold-induced sweating syndrome is caused by mutations in the CRLF1 gene .
Author Knappskog,P.M., Majewski,J., Livneh,A., Nilsen,P.T., Bringsli,J.S., Ott,J. and Boman,H.
Journal Am. J. Hum. Genet. 72 (2), 375-383 (2003)
Title CLF associates with CLC to form a functional heteromeric ligand for the CNTF receptor complex .
Author Elson,G.C., Lelievre,E., Guillet,C., Chevalier,S., Plun-Favreau,H., Froger,J., Suard,I., de Coignac,A.B., Delneste,Y., Bonnefoy,J.Y., Gauchat,J.F. and Gascan,H.
Journal Nat. Neurosci. 3 (9), 867-872 (2000)
Title Cytokine-like factor-1, a novel soluble protein, shares homology with members of the cytokine type I receptor family .
Author Elson,G.C., Graber,P., Losberger,C., Herren,S., Gretener,D., Menoud,L.N., Wells,T.N., Kosco-Vilbois,M.H. and Gauchat,J.F.
Journal J. Immunol. 161 (3), 1371-1379 (1998)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878