• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004797 Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_004797.3, 295317373
Length 4578 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, mRNA.
Product adiponectin precursor
Comment

Summary: This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010].


Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Both variants 1 and 2 encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004788.1
CDS 85..819
Misc Feature(1)208..402
Misc Feature(2)214..216
Misc Feature(3)223..225
Misc Feature(4)241..243
Misc Feature(5)268..270
Misc Feature(6)277..279
Misc Feature(7)277..279
Misc Feature(8)277..279
Misc Feature(9)286..288
Misc Feature(10)286..288
Misc Feature(11)286..288
Misc Feature(12)295..297
Misc Feature(13)310..312
Misc Feature(14)313..315
Misc Feature(15)313..315
Misc Feature(16)313..315
Misc Feature(17)340..342
Misc Feature(18)355..357
Misc Feature(19)367..369
Misc Feature(20)385..387
Misc Feature(21)385..387
Misc Feature(22)385..387
Misc Feature(23)394..396
Misc Feature(24)400..810
Misc Feature(25)772..774
Exon (1)1..76
Gene:ADIPOQ
Gene Synonym:ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
Exon (2)77..298
Gene:ADIPOQ
Gene Synonym:ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
Exon (3)299..4578
Gene:ADIPOQ
Gene Synonym:ACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
Translation MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY HDTN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+c, tdbSNP:199995287
23+g, tdbSNP:201268859
97+a, gdbSNP:201248773
108+a, g, tdbSNP:199662617
110+a, tdbSNP:114155159
111+c, gdbSNP:202117803
123+a, gdbSNP:376174575
126+c, tdbSNP:138678413
129+g, tdbSNP:2241766
147+a, gdbSNP:200633565
149+c, tdbSNP:201223375
156+a, gdbSNP:201945112
160+a, gdbSNP:200006814
180+c, tdbSNP:62622816
185+g, tdbSNP:201392172
197+a, gdbSNP:144448520
206+c, tdbSNP:200936740
207+a, gdbSNP:202071028
217+c, gdbSNP:200573126
224+c, tdbSNP:372597136
225+a, c, gdbSNP:200395572
227+a, gdbSNP:182223755
237+a, gdbSNP:202187878
245+g, tdbSNP:13061862
247+c, tdbSNP:138227502
248+a, gdbSNP:143606172
270+c, tdbSNP:375690358
275+a, gdbSNP:147185738
305+dbSNP:
305+c, tdbSNP:138835949
307+g, tdbSNP:199670988
324+c, tdbSNP:200363536
329+a, gdbSNP:200935936
333+c, tdbSNP:76533408
334+a, gdbSNP:199646033
337+g, tdbSNP:376862518
340+c, gdbSNP:371274243
342+c, tdbSNP:200623360
352+a, gdbSNP:62625753
355+c, tdbSNP:200130041
356+c, gdbSNP:200470297
357+a, cdbSNP:201912491
358+c, tdbSNP:139024247
369+a, gdbSNP:377233537
374+c, tdbSNP:370574236
384+a, gdbSNP:200011674
407+c, tdbSNP:72563731
410+a, gdbSNP:201989364
415+c, tdbSNP:17366743
418+c, tdbSNP:121917815
419+c, tdbSNP:79645624
423+a, gdbSNP:201116832
437+a, gdbSNP:202043211
439+a, c, tdbSNP:146386537
443+a, cdbSNP:200433818
450+c, tdbSNP:78129385
451+a, gdbSNP:367717792
455+a, cdbSNP:199656636
458+a, tdbSNP:370120250
475+c, tdbSNP:202200116
476+a, gdbSNP:78685763
480+c, tdbSNP:139742770
509+a, tdbSNP:199547839
520+a, tdbSNP:375589933
525+c, tdbSNP:200456618
547+c, tdbSNP:200546423
549+c, tdbSNP:201111393
552+c, gdbSNP:199706347
553+c, tdbSNP:188144290
566+c, tdbSNP:113716447
575+c, tdbSNP:185847354
591+a, gdbSNP:201645109
600+a, gdbSNP:368546659
609+c, gdbSNP:191691790
625+g, tdbSNP:372548575
652+c, gdbSNP:200035452
677+c, tdbSNP:375480082
678+c, tdbSNP:72563732
679+a, gdbSNP:144526209
699+a, gdbSNP:146595368
707+a, gdbSNP:200107352
708+c, tdbSNP:200876636
710+a, gdbSNP:199733477
719+a, gdbSNP:202013088
742+c, g, tdbSNP:183590709
745+a, c, tdbSNP:138773406
749+a, gdbSNP:374868336
806+a, cdbSNP:141205818
810+c, gdbSNP:200424832
830+c, tdbSNP:373885561
855+c, gdbSNP:201402829
858+c, tdbSNP:367776984
860+a, gdbSNP:201816379
874+c, gdbSNP:200346097
881+c, gdbSNP:201026846
882+c, tdbSNP:199695100
884+c, g, tdbSNP:4068
904+a, gdbSNP:369636003
908+a, tdbSNP:188947568
966..968+, tcgdbSNP:200307801
complement(968)-t, c, adbSNP:1501298
992+c, tdbSNP:200695138
998..999+, cdbSNP:374215428
998+c, tdbSNP:201687733
1006+a, cdbSNP:4686440
1022+a, tdbSNP:199678941
1051+a, tdbSNP:200775572
1063+c, gdbSNP:375881971
1070+c, gdbSNP:192491840
1076+a, gdbSNP:201671249
1088+g, tdbSNP:199943987
1089+a, tdbSNP:184535507
1095+a, gdbSNP:201139232
1106+a, gdbSNP:201995003
1148+g, tdbSNP:200142714
1153+c, tdbSNP:201008329
1190..1191+, adbSNP:56354395
1190+a, c, tdbSNP:73888309
1191..1192+, adbSNP:397806285
1192+a, gdbSNP:200326826
1215+a, tdbSNP:201023062
complement(1252)-c, adbSNP:1501297
1261+g, tdbSNP:201686646
1268+a, gdbSNP:200429302
1284+a, gdbSNP:201407353
1291+c, tdbSNP:199701452
1292+a, gdbSNP:200502743
1294+g, tdbSNP:201246459
1300+a, gdbSNP:199658515
1311+c, tdbSNP:200726766
1324+c, tdbSNP:201913011
1332+g, tdbSNP:199782661
1371+c, tdbSNP:186695091
1390+a, gdbSNP:191149084
1397+a, cdbSNP:6444172
1403+a, gdbSNP:200047628
1469+c, tdbSNP:201268142
1471+a, tdbSNP:201395521
1479+c, tdbSNP:138042436
1480+c, tdbSNP:199997970
1485+a, tdbSNP:200943450
1486+c, tdbSNP:73888310
1487+a, gdbSNP:200533535
1515+c, tdbSNP:6444174
1537+c, gdbSNP:202001528
1538+g, tdbSNP:200524436
1542+c, tdbSNP:201528280
1559+c, gdbSNP:201981667
1560+c, tdbSNP:199594173
1562+a, tdbSNP:184870010
1563+c, tdbSNP:201345256
1574..1575+, tdbSNP:11377702
1574+c, tdbSNP:199666996
1575+, tdbSNP:112500524
1587+g, tdbSNP:75985974
1588+g, tdbSNP:200832298
1589+a, g, tdbSNP:201468068
1632+c, tdbSNP:199639966
1633+a, gdbSNP:200900839
1635+c, tdbSNP:201604602
1639+a, gdbSNP:200134734
1655+c, tdbSNP:189760873
1667+c, tdbSNP:201409973
1677+a, tdbSNP:200054851
1684+c, tdbSNP:201272979
1685+c, tdbSNP:202179052
1693+c, tdbSNP:199970645
1694+c, tdbSNP:200960156
1697+g, tdbSNP:144144387
1725+a, gdbSNP:200401897
1729+a, tdbSNP:201244880
1749+c, tdbSNP:376929311
1756+a, gdbSNP:202034095
1761+a, gdbSNP:6796106
1768+c, tdbSNP:201578880
1790+a, gdbSNP:199555730
1805+a, gdbSNP:200464711
1815+c, tdbSNP:201119230
1816+a, gdbSNP:199714252
1820+c, tdbSNP:200677630
1821+a, gdbSNP:181861150
1834+g, tdbSNP:201897535
1849+a, gdbSNP:6414520
1863+a, cdbSNP:200906772
1868+c, tdbSNP:141988927
1877+a, cdbSNP:200173119
1878+c, tdbSNP:200839632
1893+c, tdbSNP:202019440
1928+c, tdbSNP:200076937
1957+c, tdbSNP:201224342
1961+a, gdbSNP:202148110
1967+a, gdbSNP:369092484
1968+a, tdbSNP:146300271
1999+a, tdbSNP:139644665
2004+c, gdbSNP:201163399
2029+c, tdbSNP:185270715
2031+a, c, gdbSNP:6773957
2099+a, gdbSNP:200351256
2123+a, gdbSNP:201028816
2140+a, gdbSNP:199696389
2174+a, gdbSNP:144312825
2181+g, tdbSNP:201581737
2189+g, tdbSNP:199780208
2197+c, tdbSNP:200640905
2209+c, tdbSNP:201911585
2214+c, tdbSNP:199683555
2232+c, gdbSNP:200826171
2238+c, tdbSNP:201671647
2272+c, tdbSNP:199944090
2278+a, gdbSNP:111856964
2306+g, tdbSNP:201773400
2333+a, gdbSNP:189804402
2342+a, gdbSNP:200178994
2378+c, gdbSNP:200923133
2397+a, c, tdbSNP:181947216
2399+c, tdbSNP:200333718
2401+c, tdbSNP:1063537
2415+g, tdbSNP:17846872
2434+c, gdbSNP:200197760
2438+c, gdbSNP:201518382
2446+a, gdbSNP:199645109
2464..2467+, ctatdbSNP:201377589
2490+c, tdbSNP:2082940
2495+a, cdbSNP:186321121
2503+c, gdbSNP:199666321
2509+c, tdbSNP:1063538
2523+a, gdbSNP:201911190
2545+c, tdbSNP:199784939
2577+a, gdbSNP:200646362
2587+a, gdbSNP:201916536
2594+a, gdbSNP:200009444
2608+c, tdbSNP:35469083
2648+c, tdbSNP:201399023
2649+a, cdbSNP:189927027
2654+a, cdbSNP:367701050
2665+c, tdbSNP:4686803
2670+a, gdbSNP:180780619
2674+c, gdbSNP:201817952
2689+c, tdbSNP:200095562
2699+a, tdbSNP:200930434
2717+c, tdbSNP:202199461
2721+c, tdbSNP:200492650
2727+a, cdbSNP:201749347
2741+a, gdbSNP:201981767
2747+a, gdbSNP:78816502
2751+a, gdbSNP:201347029
2787+a, c, gdbSNP:199679045
2812+a, gdbSNP:4686804
2842+a, gdbSNP:201369089
2851+c, tdbSNP:199660821
2855+g, tdbSNP:200788801
2880+a, cdbSNP:201604888
2912+a, gdbSNP:369957413
2935+a, gdbSNP:200138433
2982+a, tdbSNP:57536070
2985+a, gdbSNP:201412866
2995+a, cdbSNP:200080545
3021+a, gdbSNP:201380661
3028+g, tdbSNP:201963215
3051+c, tdbSNP:200028669
3052+c, gdbSNP:200963315
3056+c, gdbSNP:202115604
3057+a, cdbSNP:200407960
3073+c, tdbSNP:149814403
3079+c, tdbSNP:111316547
3084+a, gdbSNP:200496265
3085+g, tdbSNP:201754364
3098+g, tdbSNP:114300357
3105+c, tdbSNP:200698610
3106+a, g, tdbSNP:201077231
3116+c, tdbSNP:199719990
3161+c, tdbSNP:200710189
3180+a, gdbSNP:373022012
3181+c, tdbSNP:201387006
3195+a, gdbSNP:200026218
3201+c, tdbSNP:200794063
3208+a, cdbSNP:201993963
3224+c, tdbSNP:200144552
3249+c, tdbSNP:200846357
3261+c, gdbSNP:186490267
3309+c, tdbSNP:200077203
3326+a, tdbSNP:201231996
3351+c, tdbSNP:201967104
3371+c, tdbSNP:200427933
3378+a, tdbSNP:201055092
3395+a, tdbSNP:202205088
3401+c, gdbSNP:200360323
3402+g, tdbSNP:201059396
3416+a, gdbSNP:145887102
3417+g, tdbSNP:199697991
3425+a, gdbSNP:200307604
3440+c, tdbSNP:201279481
3444+g, tdbSNP:199743044
3470+c, tdbSNP:200703038
3476+c, gdbSNP:201660971
3506+a, cdbSNP:199682204
3524+c, tdbSNP:200826358
3526+a, gdbSNP:73888312
3530+a, gdbSNP:199945531
3533+c, tdbSNP:201119417
3534+c, tdbSNP:201997820
3541+a, gdbSNP:200147410
3551+a, gdbSNP:191393980
3611+a, tdbSNP:201040769
3624+g, tdbSNP:202032569
3637+c, tdbSNP:200335620
3642+c, tdbSNP:201012021
3651+c, tdbSNP:201691735
3652+a, gdbSNP:200198971
3686+g, tdbSNP:201410153
3687+c, tdbSNP:199666666
3714+a, gdbSNP:372829894
3718+a, c, gdbSNP:1063539
3741+c, tdbSNP:201474196
3747+a, gdbSNP:78177548
3756+a, gdbSNP:73187705
3778+a, gdbSNP:201918673
3783+a, gdbSNP:199786681
3784+c, tdbSNP:200522666
3794+a, tdbSNP:370264315
3798+a, gdbSNP:201665319
3806+a, gdbSNP:200096637
3808+a, tdbSNP:9842733
3815+c, tdbSNP:201844166
3818+a, tdbSNP:200002628
3822+c, tdbSNP:200844954
3837+a, cdbSNP:201818024
3855+c, tdbSNP:116162803
3858+c, tdbSNP:201044713
3862+c, gdbSNP:202034914
3875+c, tdbSNP:200530239
3881+g, tdbSNP:201580726
3906+c, tdbSNP:183634696
3914+c, gdbSNP:201986278
3945+c, tdbSNP:200173510
3950+c, tdbSNP:201347164
3974+c, tdbSNP:199681016
3981+c, tdbSNP:200899851
3982+a, gdbSNP:201479602
3994+c, tdbSNP:199611469
3995+a, gdbSNP:200904937
4015+c, tdbSNP:201770561
4023+c, tdbSNP:200141821
4034..4049+, tccttcctttctttctdbSNP:372964214
4047..4048+, tcdbSNP:138406805
4060..4061+, ctdbSNP:371142990
4060+c, tdbSNP:200406929
4067+c, tdbSNP:188684283
4087+c, tdbSNP:199645859
4097+c, tdbSNP:144232429
4107+c, tdbSNP:200075753
4166+c, tdbSNP:7649044
4228+a, gdbSNP:147767159
4231+c, tdbSNP:190350222
4257+c, tdbSNP:17846865
4267+c, tdbSNP:183335232
4279+a, gdbSNP:115361985
4365+a, gdbSNP:34422369
4369+a, gdbSNP:187638504
4443+a, gdbSNP:200409228
4463+a, cdbSNP:201283395
4474+c, gdbSNP:202076198
4502+c, tdbSNP:200487084
4507+a, tdbSNP:201584348
Gene SymbolADIPOQ
Gene SynonymACDC; ACRP30; ADIPQTL1; ADPN; APM-1; APM1; GBP28
Chromosome3
Locus Map3q27
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004797 Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2, mRNA. In-stock $308.00 $259.00 10
NM_001177800 Homo sapiens adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 1, mRNA. In-stock $308.00 $259.00 10
Title Adiponectin and peroxisome proliferator-activated receptor-gamma gene polymorphisms and gene-gene interactions with type 2 diabetes .
Author Ye E, Yang H, Chen L, Chen Q, Sun M, Lin Z, Yu L, Peng M, Zhang C and Lu X.
Journal Life Sci. 98 (1), 55-59 (2014)
Title The Adiponectin variants contribute to the genetic background of type 2 diabetes in Turkish population .
Author Arikoglu,H., Ozdemir,H., Kaya,D.E., Ipekci,S.H., Arslan,A., Kayis,S.A. and Gonen,M.S.
Journal Gene 534 (1), 10-16 (2014)
Title Association of adiponectin gene -11377C>G polymorphism with adiponectin levels and the metabolic syndrome in Thais .
Author Suriyaprom K, Phonrat B and Tungtrongchitr R.
Journal Asia Pac J Clin Nutr 23 (1), 167-173 (2014)
Title The role of serum adiponectin levels in women with polycystic ovarian syndrome .
Author Itoh H, Kawano Y, Furukawa Y, Matsumoto H, Yuge A and Narahara H.
Journal Clin Exp Obstet Gynecol 40 (4), 531-535 (2013)
Title The human apM-1, an adipocyte-specific gene linked to the family of TNF's and to genes expressed in activated T cells, is mapped to chromosome 1q21.3-q23, a susceptibility locus identified for familial combined hyperlipidaemia (FCH) .
Author Schaffler A, Orso E, Palitzsch KD, Buchler C, Drobnik W, Furst A, Scholmerich J and Schmitz G.
Journal Biochem. Biophys. Res. Commun. 260 (2), 416-425 (1999)
Title Identification and characterization of the human adipocyte apM-1 promoter .
Author Schaffler A, Langmann T, Palitzsch KD, Scholmerich J and Schmitz G.
Journal Biochim. Biophys. Acta 1399 (2-3), 187-197 (1998)
Title Isolation and characterization of GBP28, a novel gelatin-binding protein purified from human plasma .
Author Nakano Y, Tobe T, Choi-Miura NH, Mazda T and Tomita M.
Journal J. Biochem. 120 (4), 803-812 (1996)
Title AdipoQ is a novel adipose-specific gene dysregulated in obesity .
Author Hu E, Liang P and Spiegelman BM.
Journal J. Biol. Chem. 271 (18), 10697-10703 (1996)
Title cDNA cloning and expression of a novel adipose specific collagen-like factor, apM1 (AdiPose Most abundant Gene transcript 1) .
Author Maeda K, Okubo K, Shimomura I, Funahashi T, Matsuzawa Y and Matsubara K.
Journal Biochem. Biophys. Res. Commun. 221 (2), 286-289 (1996)
Title A novel serum protein similar to C1q, produced exclusively in adipocytes .
Author Scherer PE, Williams S, Fogliano M, Baldini G and Lodish HF.
Journal J. Biol. Chem. 270 (45), 26746-26749 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.