• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu39917 Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu39917C Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004821.2, 196259809
Length 648 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), mRNA.
Product heart- and neural crest derivatives-expressed protein 1
Comment

Summary: The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq, Jul 2008].

RefSeq NP_004812.1
CDS 257..904
Misc Feature(1)533..694
Misc Feature(2)533..694
Misc Feature(3)order(539..544,560..568,572..574,641..643,650..652)
Misc Feature(4)548..550
Misc Feature(5)548..550
Misc Feature(6)563..565
Misc Feature(7)575..577
Misc Feature(8)575..577
Misc Feature(9)575..577
Misc Feature(10)order(581..586,593..598,602..607,653..655,662..664,
Misc Feature(11)581..583
Misc Feature(12)581..583
Misc Feature(13)581..583
Exon (1)1..799
Gene:HAND1
Gene Synonym:bHLHa27; eHand; Hxt; Thing1
Exon (2)800..1738
Gene:HAND1
Gene Synonym:bHLHa27; eHand; Hxt; Thing1
Translation MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG PPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELREC IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRE LQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(23)-dbSNP:
complement(23)-g, adbSNP:115396154
complement(56)-g, adbSNP:3822714
complement(129)-c, adbSNP:993098
complement(185)-g, adbSNP:181499341
complement(210)-t, cdbSNP:201748550
complement(220)-t, adbSNP:111403472
complement(222)-g, adbSNP:376145648
complement(230)-t, cdbSNP:13171812
complement(231)-t, gdbSNP:374096842
complement(278)-t, cdbSNP:371033200
complement(302)-t, gdbSNP:200556971
complement(355)-t, cdbSNP:373192317
complement(388)-g, cdbSNP:145232171
complement(390)-g, cdbSNP:141689288
complement(418)-t, cdbSNP:138460675
complement(429)-t, gdbSNP:201496181
complement(434)-g, cdbSNP:202045612
complement(436)-t, cdbSNP:369386099
complement(445)-g, cdbSNP:201149780
complement(458)-g, cdbSNP:374965548
complement(475)-g, adbSNP:6880185
complement(495)-t, cdbSNP:201037401
complement(503)-c, adbSNP:201302313
complement(527)-g, cdbSNP:369296058
complement(535)-g, adbSNP:201302137
complement(595)-t, cdbSNP:150104384
complement(666)-c, adbSNP:374536409
complement(686)-c, adbSNP:140560109
complement(724)-t, gdbSNP:34402828
complement(756)-t, cdbSNP:202139442
complement(768)-t, cdbSNP:201984942
complement(774)-c, adbSNP:146912397
complement(787)-g, cdbSNP:34198899
complement(822)-dbSNP:
complement(822)-g, adbSNP:147677474
complement(837)-g, adbSNP:373277337
complement(871)-c, adbSNP:368908340
complement(915)-t, cdbSNP:201337632
complement(922)-g, cdbSNP:374569248
complement(925)-g, adbSNP:370439489
complement(951)-g, adbSNP:376440284
complement(987)-g, adbSNP:377327099
complement(1013)-c, adbSNP:186778831
complement(1102)-t, adbSNP:181136691
complement(1108)-t, cdbSNP:375335104
complement(1114)-t, cdbSNP:139139273
complement(1221)-g, adbSNP:189652687
complement(1338)-t, cdbSNP:370530933
complement(1349)-t, adbSNP:377533464
1398+c, tdbSNP:150779203
complement(1497..1498)-, agdbSNP:377024721
complement(1503)-g, adbSNP:184353195
complement(1556)-t, adbSNP:35542711
Gene SymbolHAND1
Gene SynonymbHLHa27; eHand; Hxt; Thing1
Chromosome5
Locus Map5q33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004821 Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), mRNA. In-stock $99.00 TBD
XM_005268531 PREDICTED: Homo sapiens heart and neural crest derivatives expressed 1 (HAND1), transcript variant X1, mRNA. On-demand TBD TBD
Title Altered mucosal DNA methylation in parallel with highly active Helicobacter pylori-related gastritis .
Author Yoshida T, Kato J, Maekita T, Yamashita S, Enomoto S, Ando T, Niwa T, Deguchi H, Ueda K, Inoue I, Iguchi M, Tamai H, Ushijima T and Ichinose M.
Journal Gastric Cancer 16 (4), 488-497 (2013)
Title Two novel HAND1 mutations in Chinese patients with ventricular septal defect .
Author Cheng Z, Lib L, Li Z, Liu M, Yan J, Wang B and Ma X.
Journal Clin. Chim. Acta 413 (7-8), 675-677 (2012)
Title A Phox2- and Hand2-dependent Hand1 cis-regulatory element reveals a unique gene dosage requirement for Hand2 during sympathetic neurogenesis .
Author Vincentz JW, VanDusen NJ, Fleming AB, Rubart M, Firulli BA, Howard
Journal J. Neurosci. 32 (6), 2110-2120 (2012)
Title Somatic mutations in NKX2-5, GATA4, and HAND1 are not a common cause of tetralogy of Fallot or hypoplastic left heart .
Author Esposito G, Butler TL, Blue GM, Cole AD, Sholler GF, Kirk EP, Grossfeld P, Perryman BM, Harvey RP and Winlaw DS.
Journal Am. J. Med. Genet. A 155A (10), 2416-2421 (2011)
Title Sequence variations of NKX2-5 and HAND1 genes in patients with atrial isomerism .
Author Hatemi AC, Gulec C, Cine N, Vural B, Hatirnaz O, Sayitoglu M, Oztunc F, Saltik L, Kansiz E and Erginel Unaltuna N.
Journal Anadolu Kardiyol Derg 11 (4), 319-328 (2011)
Title HAND proteins: molecular mediators of cardiac development and congenital heart disease .
Author Srivastava D.
Journal Trends Cardiovasc. Med. 9 (1-2), 11-18 (1999)
Title Molecular cloning of the human Hand1 gene/cDNA and its tissue-restricted expression in cytotrophoblastic cells and heart .
Author Knofler M, Meinhardt G, Vasicek R, Husslein P and Egarter C.
Journal Gene 224 (1-2), 77-86 (1998)
Title Cloning, chromosomal mapping, and expression of the human eHAND gene .
Author Russell MW, Baker P and Izumo S.
Journal Mamm. Genome 8 (11), 863-865 (1997)
Title Purification of CpG islands using a methylated DNA binding column .
Author Cross SH, Charlton JA, Nan X and Bird AP.
Journal Nat. Genet. 6 (3), 236-244 (1994)
Title An extended field trial of pyrimethamine combined with dapsone in the prophylaxis of malaria .
Author Weber,M.C., de Clarke,V., Harwin,R.M. and Shiff,C.J.
Journal Cent Afr J Med 21 (9), 187-192 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.