• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_004936 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004936.3, 47132608
Length 3878 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA.
Product cyclin-dependent kinase 4 inhibitor B isoform 1
Comment

Summary: This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_004927.2
CDS 361..777
Misc Feature(1)34..36
Misc Feature(2)397..477
Misc Feature(3)397..477
Misc Feature(4)412..690
Misc Feature(5)421..756
Misc Feature(6)496..582
Misc Feature(7)595..684
Misc Feature(8)694..774
Exon (1)1..516
Gene:CDKN2B
Gene Synonym:CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Exon (2)517..3861
Gene:CDKN2B
Gene Synonym:CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Translation MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(19)-dbSNP:
complement(19)-t, adbSNP:186697981
complement(159)-g, cdbSNP:72550842
complement(198)-t, cdbSNP:181360070
complement(270)-g, cdbSNP:150655569
complement(273)-t, cdbSNP:138552700
complement(380)-t, cdbSNP:150973276
complement(416)-t, gdbSNP:184392037
complement(556)-dbSNP:
complement(556)-g, adbSNP:144131923
complement(561)-g, cdbSNP:201282617
complement(609)-t, cdbSNP:142570894
complement(616)-t, cdbSNP:148421170
complement(682)-t, cdbSNP:202221094
complement(720)-g, adbSNP:62637622
complement(722)-t, adbSNP:191233212
complement(758)-c, adbSNP:140430251
complement(822)-t, gdbSNP:146540928
complement(881)-t, cdbSNP:189341541
complement(956)-, adbSNP:66778726
complement(989)-t, cdbSNP:184190153
complement(1100)-g, cdbSNP:191774214
complement(1116)-t, cdbSNP:3217982
complement(1140)-t, cdbSNP:3217983
complement(1270)-g, cdbSNP:3217984
complement(1310)-t, cdbSNP:3217985
complement(1433)-c, adbSNP:3217986
complement(1497)-t, cdbSNP:187657501
complement(1553)-t, cdbSNP:183610933
complement(1621..1622)-, t, g, tg, tgtgdbSNP:3028393
complement(1621)-t, adbSNP:183171776
complement(1622..1623)-, g, tgdbSNP:35965489
complement(1624..1625)-, tdbSNP:35712670
complement(1630)-g, adbSNP:190793848
complement(1633)-t, adbSNP:186836905
complement(1636)-t, gdbSNP:11792944
complement(1640)-g, adbSNP:11792943
complement(1643..1644)-, tgdbSNP:10656724
complement(1649..1650)-, gtdbSNP:66650443
complement(1650..1651)-, tgdbSNP:67263878
complement(1651..1652)-, tgdbSNP:112857145
complement(1702)-t, cdbSNP:3217987
complement(1719)-t, gdbSNP:193073423
complement(1792)-t, cdbSNP:111751296
complement(1826)-g, adbSNP:79703126
complement(1865)-g, adbSNP:140726127
complement(1951..1952)-, gdbSNP:35819291
complement(2032)-g, adbSNP:187514719
complement(2094)-g, adbSNP:10965209
complement(2194)-t, adbSNP:150924737
complement(2359)-t, cdbSNP:142459906
complement(2441)-t, gdbSNP:41306083
complement(2479)-t, cdbSNP:148786939
complement(2557)-g, cdbSNP:189152764
complement(2610)-t, cdbSNP:2285329
complement(2679)-t, cdbSNP:72693621
complement(2681)-g, adbSNP:3217988
complement(2808)-c, adbSNP:186542376
complement(2876..2877)-, tdbSNP:200100265
complement(2876)-t, adbSNP:181031884
complement(2877)-t, adbSNP:184884421
complement(2884..2885)-, tdbSNP:149822153
complement(2973)-g, adbSNP:3217989
complement(3012..3013)-, gdbSNP:58215444
complement(3013..3014)-, gdbSNP:200127607
complement(3045)-t, g, adbSNP:79203451
complement(3056)-c, adbSNP:75158970
complement(3172)-t, cdbSNP:185130567
complement(3242)-c, adbSNP:3217990
complement(3249)-t, adbSNP:145582009
complement(3323)-g, adbSNP:186915914
complement(3396)-t, cdbSNP:1063192
complement(3463..3464)-, a, aadbSNP:34503303
complement(3467..3468)-, tdbSNP:3217991
complement(3494)-c, adbSNP:78827673
complement(3533..3534)-, adbSNP:36058624
complement(3540)-g, adbSNP:3217992
complement(3594)-t, cdbSNP:3217993
complement(3703)-c, adbSNP:181736450
Gene SymbolCDKN2B
Gene SynonymCDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Chromosome9
Locus Map9p21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_004936 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA. Full Length $1357.30
ORF Sequence $159.00
NM_078487 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, mRNA. Full Length $1400.35
ORF Sequence $159.00
Title Resequencing and clinical associations of the 9p21.3 region: a comprehensive investigation in the Framingham heart study .
Author Johnson,A.D., Hwang,S.J., Voorman,A., Morrison,A., Peloso,G.M., Hsu,Y.H., Thanassoulis,G., Newton-Cheh,C., Rogers,I.S., Hoffmann,U., Freedman,J.E., Fox,C.S., Psaty,B.M., Boerwinkle,E., Cupples,L.A. and O'Donnell,C.J.
Journal Circulation 127 (7), 799-810 (2013)
Title Interferon-gamma activates expression of p15 and p16 regardless of 9p21.3 coronary artery disease risk genotype .
Author Almontashiri,N.A., Fan,M., Cheng,B.L., Chen,H.H., Roberts,R. and Stewart,A.F.
Journal J. Am. Coll. Cardiol. 61 (2), 143-147 (2013)
Title Loss of CDKN2B promotes p53-dependent smooth muscle cell apoptosis and aneurysm formation .
Author Leeper,N.J., Raiesdana,A., Kojima,Y., Kundu,R.K., Cheng,H., Maegdefessel,L., Toh,R., Ahn,G.O., Ali,Z.A., Anderson,D.R., Miller,C.L., Roberts,S.C., Spin,J.M., de Almeida,P.E., Wu,J.C., Xu,B., Cheng,K., Quertermous,M., Kundu,S., Kortekaas,K.E., Berzin,E., Downing,K.P., Dalman,R.L., Tsao,P.S., Schadt,E.E., Owens,G.K. and Quertermous,T.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (1), E1-E10 (2013)
Title Elite model for the generation of induced pluripotent cancer cells (iPCs) .
Author Lai,J., Kong,C.M., Mahalingam,D., Xie,X. and Wang,X.
Journal PLoS ONE 8 (2), E56702 (2013)
Title Methylation of p15INK4b and expression of ANRIL on chromosome 9p21 are associated with coronary artery disease .
Author Zhuang,J., Peng,W., Li,H., Wang,W., Wei,Y., Li,W. and Xu,Y.
Journal PLoS ONE 7 (10), E47193 (2012)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall,M., Bates,S. and Peters,G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title Genomic structure, expression and mutational analysis of the P15 (MTS2) gene .
Author Stone,S., Dayananth,P., Jiang,P., Weaver-Feldhaus,J.M., Tavtigian,S.V., Cannon-Albright,L. and Kamb,A.
Journal Oncogene 11 (5), 987-991 (1995)
Title Mutations in the p16INK4/MTS1/CDKN2, p15INK4B/MTS2, and p18 genes in primary and metastatic lung cancer .
Author Okamoto,A., Hussain,S.P., Hagiwara,K., Spillare,E.A., Rusin,M.R., Demetrick,D.J., Serrano,M., Hannon,G.J., Shiseki,M., Zariwala,M. et al.
Journal Cancer Res. 55 (7), 1448-1451 (1995)
Title Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function .
Author Guan,K.L., Jenkins,C.W., Li,Y., Nichols,M.A., Wu,X., O'Keefe,C.L., Matera,A.G. and Xiong,Y.
Journal Genes Dev. 8 (24), 2939-2952 (1994)
Title Deletion of p16 and p15 genes in brain tumors .
Author Jen,J., Harper,J.W., Bigner,S.H., Bigner,D.D., Papadopoulos,N., Markowitz,S., Willson,J.K., Kinzler,K.W. and Vogelstein,B.
Journal Cancer Res. 54 (24), 6353-6358 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878