• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18518 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 TBD
OHu18518C Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA. Customized vector In-stock $149.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_004936.3, 47132608
Length 417 bp
Structure linear
Update Date 15-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA.
Product cyclin-dependent kinase 4 inhibitor B isoform 1
Comment

Summary: This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_004927.2
CDS 361..777
Misc Feature(1)34..36
Misc Feature(2)397..477
Misc Feature(3)397..477
Misc Feature(4)412..690
Misc Feature(5)421..756
Misc Feature(6)496..582
Misc Feature(7)595..684
Misc Feature(8)694..774
Exon (1)1..516
Gene:CDKN2B
Gene Synonym:CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Exon (2)517..3861
Gene:CDKN2B
Gene Synonym:CDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Translation MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSAR VAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLA EERGHRDVAGYLRTATGD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
19+dbSNP:
19+a, tdbSNP:186697981
complement(23)-t, cdbSNP:377053737
complement(138)-t, cdbSNP:369032987
complement(147)-t, cdbSNP:374702031
159+c, gdbSNP:72550842
complement(198)-t, cdbSNP:181360070
complement(270)-g, cdbSNP:150655569
complement(273)-t, cdbSNP:138552700
complement(327)-g, adbSNP:377687208
complement(342)-g, adbSNP:373722871
complement(355)-g, adbSNP:369397388
complement(380)-t, cdbSNP:150973276
complement(392)-g, cdbSNP:375797351
complement(413)-g, adbSNP:372664976
complement(416)-t, gdbSNP:184392037
complement(481)-t, cdbSNP:369983875
complement(482)-t, cdbSNP:375443156
complement(556)-dbSNP:
complement(556)-g, adbSNP:144131923
complement(561)-g, cdbSNP:201282617
complement(568)-t, cdbSNP:370236504
complement(574)-t, gdbSNP:368412874
complement(609)-t, cdbSNP:142570894
complement(616)-t, cdbSNP:148421170
complement(674)-t, cdbSNP:376104829
complement(682)-t, cdbSNP:202221094
complement(686)-t, cdbSNP:377723228
complement(703)-g, adbSNP:372284765
complement(720)-g, adbSNP:62637622
722+a, tdbSNP:191233212
complement(736)-g, adbSNP:371415045
complement(758)-c, adbSNP:140430251
complement(804..806)-, gtcdbSNP:375565366
complement(822)-t, gdbSNP:146540928
complement(829)-g, adbSNP:368728826
complement(881)-t, cdbSNP:189341541
complement(989)-t, cdbSNP:184190153
complement(1100)-g, cdbSNP:191774214
complement(1116)-t, cdbSNP:386581078
1116+c, tdbSNP:3217982
complement(1140)-t, cdbSNP:386581079
1140+c, tdbSNP:3217983
complement(1270)-g, cdbSNP:3217984
complement(1310)-t, cdbSNP:386581080
1310+c, tdbSNP:3217985
1433+a, cdbSNP:3217986
complement(1433)-t, gdbSNP:386581081
complement(1497)-t, cdbSNP:187657501
complement(1553)-t, cdbSNP:183610933
complement(1621..1622)-, t, g, tg, tgtgdbSNP:3028393
complement(1621..1622)-, tg, tgtgdbSNP:386361169
1621+a, tdbSNP:183171776
complement(1622..1623)-, g, tgdbSNP:35965489
complement(1623..1624)-, tdbSNP:35712670
1630+a, gdbSNP:190793848
1633+a, tdbSNP:186836905
complement(1636)-t, gdbSNP:11792944
complement(1640)-g, adbSNP:11792943
complement(1649..1650)-, gtdbSNP:66650443
complement(1650..1651)-, tgdbSNP:369134867
complement(1651..1652)-, tg, tgtgtgdbSNP:112857145
complement(1702)-t, cdbSNP:386581082
1702+c, tdbSNP:3217987
complement(1719)-t, gdbSNP:193073423
complement(1792)-t, cdbSNP:111751296
complement(1826)-g, adbSNP:79703126
1865+a, gdbSNP:140726127
complement(1950..1951)-, gdbSNP:35819291
complement(2032)-g, adbSNP:187514719
complement(2094)-g, adbSNP:10965209
complement(2194)-t, adbSNP:150924737
complement(2359)-t, cdbSNP:142459906
complement(2395)-c, adbSNP:377277689
complement(2441)-t, gdbSNP:41306083
complement(2479)-t, cdbSNP:148786939
complement(2557)-g, cdbSNP:189152764
2610+c, tdbSNP:2285329
complement(2679)-t, cdbSNP:72693621
2681+a, gdbSNP:3217988
complement(2681)-t, cdbSNP:386581083
complement(2808)-c, adbSNP:186542376
complement(2876)-t, adbSNP:181031884
complement(2877)-t, adbSNP:184884421
complement(2883..2884)-, tdbSNP:149822153
complement(2973)-g, adbSNP:3217989
complement(3005..3006)-, gdbSNP:397975070
complement(3013..3014)-, gdbSNP:58215444
complement(3045)-t, g, adbSNP:79203451
complement(3056)-c, adbSNP:75158970
complement(3172)-t, cdbSNP:185130567
3242+a, cdbSNP:3217990
complement(3249)-t, adbSNP:145582009
complement(3323)-g, adbSNP:186915914
3396+c, tdbSNP:1063192
complement(3456..3457)-, adbSNP:397823852
complement(3463..3464)-, a, aadbSNP:34503303
complement(3464..3465)-, tdbSNP:3217991
complement(3494)-c, adbSNP:78827673
complement(3532..3533)-, adbSNP:36058624
3540+a, gdbSNP:3217992
complement(3540)-g, adbSNP:386581084
complement(3584)-g, adbSNP:368814059
3594+c, tdbSNP:3217993
complement(3594)-g, adbSNP:386581085
complement(3703)-c, adbSNP:181736450
Gene SymbolCDKN2B
Gene SynonymCDK4I; INK4B; MTS2; P15; p15INK4b; TP15
Chromosome9
Locus Map9p21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004936 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mRNA. In-stock $99.00 TBD
NM_078487 Homo sapiens cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 2, mRNA. On-demand TBD TBD
Title Genome-wide association study identifies three novel loci for type 2 diabetes .
Author Hara K, Fujita H, Johnson TA, Yamauchi T, Yasuda K, Horikoshi M, Peng C, Hu C, Ma RC, Imamura M, Iwata M, Tsunoda T, Morizono T, Shojima N, So WY, Leung TF, Kwan P, Zhang R, Wang J, Yu W, Maegawa H, Hirose H, Kaku K, Ito C, Watada H, Tanaka Y, Tobe K, Kashiwagi A, Kawamori R, Jia W, Chan JC, Teo YY, Shyong TE, Kamatani N, Kubo M, Maeda S and Kadowaki T.
Journal Hum. Mol. Genet. 23 (1), 239-246 (2014)
Title The relationship between five widely-evaluated variants in CDKN2A/B and CDKAL1 genes and the risk of type 2 diabetes: a meta-analysis .
Author Peng F, Hu D, Gu C, Li X, Li Y, Jia N, Chu S, Lin J and Niu W.
Journal Gene 531 (2), 435-443 (2013)
Title Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia .
Author Berndt SI, Skibola CF, Joseph V, Camp NJ, Nieters A, Wang Z, Cozen W, Monnereau A, Wang SS, Kelly RS, Lan Q, Teras LR, Chatterjee N, Chung CC, Yeager M, Brooks-Wilson AR, Hartge P, Purdue MP, Birmann BM, Armstrong BK, Cocco P, Zhang Y, Severi G, Zeleniuch-Jacquotte A, Lawrence C, Burdette L, Yuenger J, Hutchinson A, Jacobs KB, Call TG, Shanafelt TD, Novak AJ, Kay NE, Liebow M, Wang AH, Smedby KE, Adami HO, Melbye M, Glimelius B, Chang ET, Glenn M, Curtin K, Cannon-Albright LA, Jones B, Diver WR, Link BK, Weiner GJ, Conde L, Bracci PM, Riby J, Holly EA, Smith MT, Jackson RD, Tinker LF, Benavente Y, Becker N, Boffetta P, Brennan P, Foretova L, Maynadie M, McKay J, Staines A, Rabe KG, Achenbach SJ, Vachon CM, Goldin LR, Strom SS, Lanasa MC, Spector LG, Leis JF, Cunningham JM, Weinberg JB, Morrison VA, Caporaso NE, Norman AD, Linet MS, De Roos AJ, Morton LM, Severson RK, Riboli E, Vineis P, Kaaks R, Trichopoulos D, Masala G, Weiderpass E, Chirlaque MD, Vermeulen RC, Travis RC, Giles GG, Albanes D, Virtamo J, Weinstein S, Clavel J, Zheng T, Holford TR, Offit K, Zelenetz A, Klein RJ, Spinelli JJ, Bertrand KA, Laden F, Giovannucci E, Kraft P, Kricker A, Turner J, Vajdic CM, Ennas MG, Ferri GM, Miligi L, Liang L, Sampson J, Crouch S, Park JH, North KE, Cox A, Snowden JA, Wright J, Carracedo A, Lopez-Otin C, Bea S, Salaverria I, Martin-Garcia D, Campo E, Fraumeni JF Jr, de Sanjose S, Hjalgrim H, Cerhan JR, Chanock SJ, Rothman N and Slager SL.
Journal Nat. Genet. 45 (8), 868-876 (2013)
Title Expression of p15INK(4)b and p57KIP(2) and relationship with clinicopathological features and prognosis in patients with vulvar squamous cell carcinoma .
Author Holm R, Forsund M, Nguyen MT, Nesland JM and Trope CG.
Journal PLoS ONE 8 (4), E61273 (2013)
Title Quantitative comparison of CDKN2B methylation in pediatric and adult myelodysplastic syndromes .
Author Kim M, Kook H, Park HJ, Ahn HS, Lee KC, Lee KS, Park SK, Lim JY, Kim HK, Han DK and Lee DS.
Journal Acta Haematol. 130 (2), 115-121 (2013)
Title Evidence for different modes of action of cyclin-dependent kinase inhibitors: p15 and p16 bind to kinases, p21 and p27 bind to cyclins .
Author Hall M, Bates S and Peters G.
Journal Oncogene 11 (8), 1581-1588 (1995)
Title Genomic structure, expression and mutational analysis of the P15 (MTS2) gene .
Author Stone S, Dayananth P, Jiang P, Weaver-Feldhaus JM, Tavtigian SV, Cannon-Albright L and Kamb A.
Journal Oncogene 11 (5), 987-991 (1995)
Title Mutations in the p16INK4/MTS1/CDKN2, p15INK4B/MTS2, and p18 genes in primary and metastatic lung cancer .
Author Okamoto A, Hussain SP, Hagiwara K, Spillare EA, Rusin MR, Demetrick DJ, Serrano M, Hannon GJ, Shiseki M and Zariwala M.
Journal Cancer Res. 55 (7), 1448-1451 (1995)
Title Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function .
Author Guan KL, Jenkins CW, Li Y, Nichols MA, Wu X, O'Keefe CL, Matera AG and Xiong Y.
Journal Genes Dev. 8 (24), 2939-2952 (1994)
Title Deletion of p16 and p15 genes in brain tumors .
Author Jen J, Harper JW, Bigner SH, Bigner DD, Papadopoulos N, Markowitz S, Willson JK, Kinzler KW and Vogelstein B.
Journal Cancer Res. 54 (24), 6353-6358 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.