• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens epiphycan (EPYC), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004950 Homo sapiens epiphycan (EPYC), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_004950.4, 223941903
Length 1553 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens epiphycan (EPYC), mRNA.
Product epiphycan precursor
Comment

Summary: Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC030958.1, U59111.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: full length.

RefSeq NP_004941.2
CDS 94..1062
Misc Feature(1)88..90
Misc Feature(2)88..90
Misc Feature(3)454..528
Misc Feature(4)523..588
Misc Feature(5)<577..840
Misc Feature(6)595..660
Misc Feature(7)598..840
Misc Feature(8)667..732
Misc Feature(9)805..867
Misc Feature(10)808..996
Misc Feature(11)868..933
Misc Feature(12)961..1023
Exon (1)1..80
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (2)81..258
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (3)259..433
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (4)434..592
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (5)593..795
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (6)796..891
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Exon (7)892..1539
Gene:EPYC
Gene Synonym:DSPG3; Pg-Lb; PGLB; SLRR3B
Translation MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIAT VMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLL CTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLIS EIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLH HLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNP INLSKTPQAYMCLPRLPVGSLV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-c, adbSNP:10777279
complement(15)-t, cdbSNP:192496687
complement(41)-g, cdbSNP:113814381
complement(56)-g, adbSNP:187150108
complement(139)-t, cdbSNP:201528697
complement(140)-t, gdbSNP:201811365
complement(155..156)-, gdbSNP:35141815
complement(167)-t, gdbSNP:142841602
complement(189)-t, gdbSNP:76171854
complement(233)-t, gdbSNP:141571083
complement(238)-t, cdbSNP:115626888
complement(245)-g, adbSNP:116545939
complement(248)-t, cdbSNP:17852857
complement(341)-dbSNP:
complement(341)-t, cdbSNP:34037526
complement(347)-t, cdbSNP:137968283
complement(407)-t, cdbSNP:115633176
complement(435)-dbSNP:
complement(435)-g, cdbSNP:202056300
complement(500)-t, gdbSNP:183846621
complement(504)-g, adbSNP:150301480
complement(508)-t, gdbSNP:140043768
complement(512)-g, adbSNP:190547958
complement(518)-g, adbSNP:187299979
complement(522)-t, cdbSNP:115968659
complement(528)-g, adbSNP:151128680
complement(542)-g, cdbSNP:17784152
complement(543)-g, adbSNP:199845057
complement(544)-g, adbSNP:114231682
complement(630)-dbSNP:
complement(630)-t, gdbSNP:34062416
complement(646)-g, cdbSNP:146839750
complement(655)-g, adbSNP:143768297
complement(688)-t, gdbSNP:140084607
complement(712)-g, adbSNP:144263793
complement(731)-t, cdbSNP:1135866
complement(745)-t, cdbSNP:149984693
complement(749)-t, cdbSNP:139254082
complement(796)-dbSNP:
complement(796)-t, cdbSNP:116772978
complement(839)-t, adbSNP:150809530
complement(861)-g, adbSNP:114357917
complement(894)-dbSNP:
complement(894)-t, adbSNP:114893153
complement(915)-g, cdbSNP:142875982
complement(916)-t, cdbSNP:138857092
complement(923)-g, c, adbSNP:34988585
complement(935)-t, gdbSNP:1135867
complement(945)-g, cdbSNP:116446912
complement(969)-t, cdbSNP:148008224
complement(1014)-t, adbSNP:1135869
complement(1019)-t, gdbSNP:115903918
complement(1036)-g, adbSNP:148834797
complement(1057)-g, cdbSNP:138373628
complement(1073)-g, adbSNP:192133142
complement(1085)-g, adbSNP:201241116
complement(1088)-g, adbSNP:202019480
complement(1202..1203)-, ttatadbSNP:3047073
complement(1202)-t, adbSNP:75990266
complement(1206..1207)-, ttatadbSNP:67493115
complement(1207..1208)-, attatdbSNP:34070406
complement(1208..1209)-, attatdbSNP:5799968
complement(1337)-g, adbSNP:117759717
complement(1396)-t, cdbSNP:77960754
complement(1405)-g, cdbSNP:188412909
Gene SymbolEPYC
Gene SynonymDSPG3; Pg-Lb; PGLB; SLRR3B
Chromosome12
Locus Map12q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_004950 Homo sapiens epiphycan (EPYC), mRNA. On-demand $549.00 14
Title Linkage of posterior amorphous corneal dystrophy to chromosome 12q21.33 and exclusion of coding region mutations in KERA, LUM, DCN, and EPYC .
Author Aldave,A.J., Rosenwasser,G.O., Yellore,V.S., Papp,J.C., Sobel,E.M., Pham,M.N., Chen,M.C., Dandekar,S., Sripracha,R., Rayner,S.A., Sassani,J.W. and Gorin,M.B.
Journal Invest. Ophthalmol. Vis. Sci. 51 (8), 4006-4012 (2010)
Title The association of haplotype at the lumican gene with high myopia susceptibility in Taiwanese patients .
Author Chen,Z.T., Wang,I.J., Shih,Y.F. and Lin,L.L.
Journal Ophthalmology 116 (10), 1920-1927 (2009)
Title An evaluation of OPTC and EPYC as candidate genes for high myopia .
Author Wang,P., Li,S., Xiao,X., Guo,X. and Zhang,Q.
Journal Mol. Vis. 15, 2045-2049 (2009)
Title Autosomal dominant cornea plana is not associated with pathogenic mutations in DCN, DSPG3, FOXC1, KERA, LUM, or PITX2 .
Author Aldave,A.J., Sonmez,B., Bourla,N., Schultz,G., Papp,J.C., Salem,A.K., Rayner,S.A. and Yellore,V.S.
Journal Ophthalmic Genet. 28 (2), 57-67 (2007)
Title The association of single nucleotide polymorphisms in the 5'-regulatory region of the lumican gene with susceptibility to high myopia in Taiwan .
Author Wang,I.J., Chiang,T.H., Shih,Y.F., Hsiao,C.K., Lu,S.C., Hou,Y.C. and Lin,L.L.
Journal Mol. Vis. 12, 852-857 (2006)
Title Genomic characterization of human DSPG3 .
Author Deere,M., Dieguez,J.L., Yoon,S.J., Hewett-Emmett,D., de la Chapelle,A. and Hecht,J.T.
Journal Genome Res. 9 (5), 449-456 (1999)
Title Characterization of human DSPG3, a small dermatan sulfate proteoglycan .
Author Deere,M., Johnson,J., Garza,S., Harrison,W.R., Yoon,S.J., Elder,F.F., Kucherlapati,R., Hook,M. and Hecht,J.T.
Journal Genomics 38 (3), 399-404 (1996)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.