Sequence in raw or FASTA format:
Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA.
| RefSeq Version | NM_004960.3, 270265814 |
| Length | 5119 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA. |
| Product | RNA-binding protein FUS isoform 1 |
| Comment | Summary: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. |
| RefSeq | NP_004951.1 |
| CDS | 106..1686 | Exon (1) | 1..118 | Exon (2) | 1..118 | Exon (3) | 119..143 | Exon (4) | 144..295 | Exon (5) | 296..440 | Exon (6) | 441..628 | Exon (7) | 629..869 | Exon (8) | 870..904 | Exon (9) | 905..937 | Exon (10) | 938..1041 | Exon (11) | 1042..1171 | Exon (12) | 1172..1273 | Exon (13) | 1274..1397 | Exon (14) | 1398..1498 | Exon (15) | 1499..1646 | Exon (16) | 1647..5119 |
| Translation | MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | FUS |
| Gene Synonym | ALS6; FUS1; HNRNPP2; POMP75; TLS |
| Chromosome | 16 |
| Locus Map | 16p11.2 |
| All Transcripts | NM_004960 , NM_001170937 , NM_001170634 |
| Title | The spectrum and severity of FUS-immunoreactive inclusions in the frontal and temporal lobes of ten cases of neuronal intermediate filament inclusion disease . |
| Author | Armstrong,R.A., Gearing,M., Bigio,E.H., Cruz-Sanchez,F.F., Duyckaerts,C., Mackenzie,I.R., Perry,R.H., Skullerud,K., Yokoo,H. and Cairns,N.J. |
| Journal | Acta Neuropathol. 121 (2), 219-228 (2011) |
| Title | TLS and PRMT1 synergistically coactivate transcription at the survivin promoter through TLS arginine methylation . |
| Author | Du,K., Arai,S., Kawamura,T., Matsushita,A. and Kurokawa,R. |
| Journal | Biochem. Biophys. Res. Commun. 404 (4), 991-996 (2011) |
| Title | Amyotrophic lateral sclerosis-associated proteins TDP-43 and FUS/TLS function in a common biochemical complex to co-regulate HDAC6 mRNA . |
| Author | Kim,S.H., Shanware,N.P., Bowler,M.J. and Tibbetts,R.S. |
| Journal | J. Biol. Chem. 285 (44), 34097-34105 (2010) |
| Title | TDP-43 and FUS in amyotrophic lateral sclerosis and frontotemporal dementia . |
| Author | Mackenzie,I.R., Rademakers,R. and Neumann,M. |
| Journal | Lancet Neurol 9 (10), 995-1007 (2010) |
| Title | Kinome profiling of myxoid liposarcoma reveals NF-kappaB-pathway kinase activity and casein kinase II inhibition as a potential treatment option . |
| Author | Willems,S.M., Schrage,Y.M., Bruijn,I.H., Szuhai,K., Hogendoorn,P.C. and Bovee,J.V. |
| Journal | Mol. Cancer 9, 257 (2010) |
| Title | Characterization of the CHOP breakpoints and fusion transcripts in myxoid liposarcomas with the 12;16 translocation . |
| Author | Panagopoulos,I., Mandahl,N., Ron,D., Hoglund,M., Nilbert,M., Mertens,F., Mitelman,F. and Aman,P. |
| Journal | Cancer Res. 54 (24), 6500-6503 (1994) |
| Title | An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation . |
| Author | Ichikawa,H., Shimizu,K., Hayashi,Y. and Ohki,M. |
| Journal | Cancer Res. 54 (11), 2865-2868 (1994) |
| Title | Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma . |
| Author | Crozat,A., Aman,P., Mandahl,N. and Ron,D. |
| Journal | Nature 363 (6430), 640-644 (1993) |
| Title | Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma . |
| Author | Rabbitts,T.H., Forster,A., Larson,R. and Nathan,P. |
| Journal | Nat. Genet. 4 (2), 175-180 (1993) |
| Title | Localization of the chromosomal breakpoints of the t(12;16) in liposarcoma to subbands 12q13.3 and 16p11.2 . |
| Author | Eneroth,M., Mandahl,N., Heim,S., Willen,H., Rydholm,A., Alberts,K.A. and Mitelman,F. |
| Journal | Cancer Genet. Cytogenet. 48 (1), 101-107 (1990) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |