• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_004960 Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA. ORF Sequence $458.49
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_004960.3, 270265814
Length 5119 bp
Structure linear
Update Date 20-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA.
Product RNA-binding protein FUS isoform 1
Comment

Summary: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004951.1
CDS 106..1686
Misc Feature(1)4..6
Misc Feature(2)4..6
Misc Feature(3)628..630
Misc Feature(4)628..630
Misc Feature(5)751..753
Misc Feature(6)757..759
Misc Feature(7)766..768
Misc Feature(8)829..831
Misc Feature(9)835..837
Misc Feature(10)835..837
Misc Feature(11)847..849
Misc Feature(12)856..858
Misc Feature(13)880..882
Misc Feature(14)<895..>1215
Misc Feature(15)901..906
Misc Feature(16)934..936
Misc Feature(17)961..1209
Misc Feature(18)961..963
Misc Feature(19)order(967..969,1111..1113,1117..1119)
Misc Feature(20)1201..1209
Misc Feature(21)1234..1236
Misc Feature(22)1252..1254
Misc Feature(23)1261..1263
Misc Feature(24)1261..1263
Misc Feature(25)1267..1269
Misc Feature(26)1267..1269
Misc Feature(27)1285..1287
Misc Feature(28)1324..1326
Misc Feature(29)1381..1452
Misc Feature(30)1522..1524
Misc Feature(31)1531..1533
Misc Feature(32)1546..1548
Misc Feature(33)1558..1560
Misc Feature(34)1564..1566
Misc Feature(35)1564..1566
Misc Feature(36)1576..1578
Misc Feature(37)1588..1590
Misc Feature(38)1597..1599
Misc Feature(39)1612..1614
Exon (1)1..118
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (2)119..143
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (3)144..295
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (4)296..440
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (5)441..628
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (6)629..869
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (7)870..904
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (8)905..937
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (9)938..1041
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (10)1042..1171
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (11)1172..1273
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (12)1274..1397
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (13)1398..1498
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (14)1499..1646
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (15)1647..5119
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Translation MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
48+c, tdbSNP:142684066
52+c, tdbSNP:929867
57+a, gdbSNP:200997075
58+a, cdbSNP:199671743
59+a, gdbSNP:72550864
63+c, tdbSNP:199912346
67+a, gdbSNP:67676356
129+dbSNP:
129+a, gdbSNP:202111940
152+dbSNP:
152+c, tdbSNP:139980267
157+a, c, tdbSNP:144888138
171+a, gdbSNP:147877613
179+a, cdbSNP:141516414
202+c, tdbSNP:17852338
224+c, gdbSNP:147066627
237+c, tdbSNP:72550883
249+a, gdbSNP:80060438
252+a, cdbSNP:741810
258+c, tdbSNP:61733962
275+c, tdbSNP:12446646
293+a, gdbSNP:140883211
303+dbSNP:
303+c, tdbSNP:144853447
324+g, tdbSNP:150858484
348+c, tdbSNP:138534966
378+c, tdbSNP:73530286
396+c, tdbSNP:1052352
397+c, tdbSNP:137981501
423+c, tdbSNP:200264709
430+a, gdbSNP:149625398
445+dbSNP:
445+g, tdbSNP:186802889
509+a, gdbSNP:61732970
557+c, tdbSNP:144342946
589+a, cdbSNP:200264565
593+a, gdbSNP:202150272
606+g, tdbSNP:78117286
635+dbSNP:
635+a, gdbSNP:113216743
676+a, gdbSNP:148758737
681+a, gdbSNP:3764325
707+g, tdbSNP:144950807
741+c, tdbSNP:147528034
750+a, cdbSNP:113554011
751+c, tdbSNP:267606832
771+c, tdbSNP:61732969
775+a, gdbSNP:139909611
780+c, tdbSNP:140003720
789+c, tdbSNP:151073460
792+c, tdbSNP:140994262
807+c, tdbSNP:149785330
821+a, cdbSNP:145013063
869+g, tdbSNP:149076460
893+dbSNP:
893+a, gdbSNP:144917373
918+dbSNP:
918+a, cdbSNP:199745766
936+c, tdbSNP:138746304
954+dbSNP:
954+c, tdbSNP:192350464
1011+c, tdbSNP:140260536
1074..1075+, adbSNP:34752278
1185+dbSNP:
1185+c, tdbSNP:190724342
1191+c, tdbSNP:145232220
1256+a, gdbSNP:200292328
1261+a, cdbSNP:61733965
1293+dbSNP:
1293+c, gdbSNP:41292384
1300+g, tdbSNP:41292386
1302+g, tdbSNP:76570520
1312..1313+, gdbSNP:141251217
1397+c, tdbSNP:186547381
1453+dbSNP:
1453+c, tdbSNP:201533156
1489+c, tdbSNP:199674833
1499+a, gdbSNP:141684472
1547+a, gdbSNP:111705357
1551+c, tdbSNP:112061837
1558+c, tdbSNP:201772423
1565+a, gdbSNP:201608365
1567+a, gdbSNP:200903051
1569+c, tdbSNP:150529460
1589+c, tdbSNP:11557276
1613+a, gdbSNP:10684
1625+a, gdbSNP:267606831
1635+a, gdbSNP:1132415
1656+dbSNP:
1656+c, gdbSNP:121909667
1658+a, gdbSNP:121909669
1666+c, g, tdbSNP:121909668
1667+a, gdbSNP:121909671
1671+a, gdbSNP:138901914
1675+a, tdbSNP:267606833
1727+c, g, tdbSNP:80301724
1862+c, tdbSNP:182573197
1900+c, tdbSNP:140875749
1989+c, tdbSNP:187266535
2021+g, tdbSNP:192206514
2100+a, tdbSNP:80269012
2143+a, gdbSNP:184638686
2164+c, tdbSNP:188934339
2177+g, tdbSNP:73530293
2247+c, tdbSNP:192705444
2250+c, tdbSNP:184121285
2312+a, gdbSNP:115626460
2417+c, tdbSNP:145145929
2456+c, gdbSNP:4889537
2493+, adbSNP:35061472
2596+c, tdbSNP:118018900
2675+c, tdbSNP:114772555
2712+a, gdbSNP:189491337
2720+c, tdbSNP:181164144
2738+c, tdbSNP:147581197
2775+a, gdbSNP:184277413
2830..2831+, acdbSNP:201043198
2834+a, tdbSNP:140326191
2835+a, gdbSNP:189016242
2985+c, gdbSNP:142052066
3106+c, tdbSNP:73530295
3162+c, tdbSNP:11860134
3234+a, cdbSNP:181731798
3241+c, tdbSNP:151232336
3378+c, tdbSNP:187382003
3436+c, tdbSNP:191806441
3437+a, gdbSNP:140395401
3489..3490+, gdbSNP:35444115
3489+c, tdbSNP:16956408
3511+a, cdbSNP:12922585
3513+a, cdbSNP:12922587
3544+a, gdbSNP:150365928
3552..3554+, aacdbSNP:199804607
3620+g, tdbSNP:75995175
3678+a, cdbSNP:146490489
3684+c, tdbSNP:182437252
3691+g, tdbSNP:140979886
3702+a, tdbSNP:145070922
3966+c, tdbSNP:185829316
4023+g, tdbSNP:138859808
4129+a, gdbSNP:189787862
4172+a, gdbSNP:73530298
4364+a, gdbSNP:116513340
4371+c, tdbSNP:71389498
4385+c, gdbSNP:182444257
4386+a, gdbSNP:187141416
4480+c, gdbSNP:17839571
4558+g, tdbSNP:77728373
4633+c, tdbSNP:190455267
4641+a, gdbSNP:149361851
4674+c, tdbSNP:73530301
4707+a, tdbSNP:78368537
4709+a, tdbSNP:75091214
4791+a, tdbSNP:183045547
4840+a, cdbSNP:188668421
4860+a, cdbSNP:3764324
4917+c, tdbSNP:193018950
4984+c, gdbSNP:184109677
5036+g, tdbSNP:187529579
Gene SymbolFUS
Gene SynonymALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Chromosome16
Locus Map16p11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001170634 Homo sapiens fused in sarcoma (FUS), transcript variant 3, mRNA. Full Length $2302.20
ORF Sequence $457.62
NM_001170937 Homo sapiens fused in sarcoma (FUS), transcript variant 4, mRNA. Full Length $2298.15
ORF Sequence $455.01
NM_004960 Homo sapiens fused in sarcoma (FUS), transcript variant 1, mRNA. Full Length $2303.55
ORF Sequence $458.49
Title The RRM domain of human fused in sarcoma protein reveals a non-canonical nucleic acid binding site .
Author Liu,X., Niu,C., Ren,J., Zhang,J., Xie,X., Zhu,H., Feng,W. and Gong,W.
Journal Biochim. Biophys. Acta 1832 (2), 375-385 (2013)
Title FUS binds the CTD of RNA polymerase II and regulates its phosphorylation at Ser2 .
Author Schwartz,J.C., Ebmeier,C.C., Podell,E.R., Heimiller,J., Taatjes,D.J. and Cech,T.R.
Journal Genes Dev. 26 (24), 2690-2695 (2012)
Title FUS stimulates microRNA biogenesis by facilitating co-transcriptional Drosha recruitment .
Author Morlando,M., Dini Modigliani,S., Torrelli,G., Rosa,A., Di Carlo,V., Caffarelli,E. and Bozzoni,I.
Journal EMBO J. 31 (24), 4502-4510 (2012)
Title Roles of ataxin-2 in pathological cascades mediated by TAR DNA-binding protein 43 (TDP-43) and Fused in Sarcoma (FUS) .
Author Nihei,Y., Ito,D. and Suzuki,N.
Journal J. Biol. Chem. 287 (49), 41310-41323 (2012)
Title Gene expression responses to FUS, EWS, and TAF15 reduction and stress granule sequestration analyses identifies FET-protein non-redundant functions .
Author Blechingberg,J., Luo,Y., Bolund,L., Damgaard,C.K. and Nielsen,A.L.
Journal PLoS ONE 7 (9), E46251 (2012)
Title Characterization of the CHOP breakpoints and fusion transcripts in myxoid liposarcomas with the 12;16 translocation .
Author Panagopoulos,I., Mandahl,N., Ron,D., Hoglund,M., Nilbert,M., Mertens,F., Mitelman,F. and Aman,P.
Journal Cancer Res. 54 (24), 6500-6503 (1994)
Title An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation .
Author Ichikawa,H., Shimizu,K., Hayashi,Y. and Ohki,M.
Journal Cancer Res. 54 (11), 2865-2868 (1994)
Title Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma .
Author Crozat,A., Aman,P., Mandahl,N. and Ron,D.
Journal Nature 363 (6430), 640-644 (1993)
Title Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma .
Author Rabbitts,T.H., Forster,A., Larson,R. and Nathan,P.
Journal Nat. Genet. 4 (2), 175-180 (1993)
Title Localization of the chromosomal breakpoints of the t(12;16) in liposarcoma to subbands 12q13.3 and 16p11.2 .
Author Eneroth,M., Mandahl,N., Heim,S., Willen,H., Rydholm,A., Alberts,K.A. and Mitelman,F.
Journal Cancer Genet. Cytogenet. 48 (1), 101-107 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878