• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens FUS RNA binding protein (FUS), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004960 Homo sapiens FUS RNA binding protein (FUS), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_004960.3, 270265814
Length 5119 bp
Structure linear
Update Date 14-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens FUS RNA binding protein (FUS), transcript variant 1, mRNA.
Product RNA-binding protein FUS isoform 1
Comment

Summary: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_004951.1
CDS 106..1686
Misc Feature(1)4..6
Misc Feature(2)4..6
Misc Feature(3)628..630
Misc Feature(4)628..630
Misc Feature(5)751..753
Misc Feature(6)757..759
Misc Feature(7)766..768
Misc Feature(8)829..831
Misc Feature(9)835..837
Misc Feature(10)835..837
Misc Feature(11)847..849
Misc Feature(12)856..858
Misc Feature(13)880..882
Misc Feature(14)<895..>1227
Misc Feature(15)901..906
Misc Feature(16)934..936
Misc Feature(17)952..1209
Misc Feature(18)961..963
Misc Feature(19)1234..1236
Misc Feature(20)1252..1254
Misc Feature(21)1261..1263
Misc Feature(22)1261..1263
Misc Feature(23)1267..1269
Misc Feature(24)1267..1269
Misc Feature(25)1285..1287
Misc Feature(26)1324..1326
Misc Feature(27)1369..1452
Misc Feature(28)1522..1524
Misc Feature(29)1531..1533
Misc Feature(30)1546..1548
Misc Feature(31)1558..1560
Misc Feature(32)1564..1566
Misc Feature(33)1564..1566
Misc Feature(34)1576..1578
Misc Feature(35)1588..1590
Misc Feature(36)1597..1599
Misc Feature(37)1612..1614
Exon (1)1..118
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (2)119..143
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (3)144..295
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (4)296..440
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (5)441..628
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (6)629..869
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (7)870..904
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (8)905..937
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (9)938..1041
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (10)1042..1171
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (11)1172..1273
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (12)1274..1397
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (13)1398..1498
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (14)1499..1646
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Exon (15)1647..5119
Gene:FUS
Gene Synonym:ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Translation MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
20+a, gdbSNP:377110060
48+c, tdbSNP:142684066
complement(52)-t, cdbSNP:929867
57+a, gdbSNP:200997075
58+a, c, tdbSNP:199671743
59+a, gdbSNP:72550864
62+a, gdbSNP:370320909
63+c, tdbSNP:199912346
64+g, tdbSNP:367552345
67+a, gdbSNP:67676356
84+c, gdbSNP:367908240
129+dbSNP:
129+a, gdbSNP:202111940
152+dbSNP:
152+c, tdbSNP:139980267
157+a, c, tdbSNP:144888138
171+a, gdbSNP:147877613
179+a, cdbSNP:141516414
202+c, tdbSNP:17852338
204+c, tdbSNP:371503663
224+c, gdbSNP:147066627
237+c, tdbSNP:72550883
249+a, gdbSNP:80060438
252+a, cdbSNP:741810
258+c, tdbSNP:61733962
275+c, tdbSNP:12446646
293+a, gdbSNP:140883211
303+dbSNP:
303+c, tdbSNP:144853447
324+g, tdbSNP:150858484
348+c, tdbSNP:138534966
370+a, tdbSNP:372638663
378+c, tdbSNP:73530286
396+c, tdbSNP:1052352
396+c, tdbSNP:386514294
405+c, tdbSNP:376424892
409+c, gdbSNP:371030047
422+c, tdbSNP:374191107
423+c, tdbSNP:200264709
434+c, tdbSNP:368404370
445+dbSNP:
445+g, tdbSNP:186802889
480+c, gdbSNP:368148475
509+a, gdbSNP:61732970
557+c, tdbSNP:144342946
559+c, tdbSNP:376583452
589+a, cdbSNP:200264565
593+a, gdbSNP:202150272
606+g, tdbSNP:78117286
609+a, tdbSNP:375535815
620+c, gdbSNP:374434160
635+dbSNP:
635+a, gdbSNP:113216743
637+a, gdbSNP:368730072
650+c, tdbSNP:375737143
664+a, gdbSNP:370954028
676+a, gdbSNP:148758737
complement(681)-g, adbSNP:3764325
707+g, tdbSNP:144950807
721+a, gdbSNP:387906628
741+c, tdbSNP:147528034
750+a, cdbSNP:113554011
751+c, tdbSNP:267606832
771..772+, ggcdbSNP:372671599
771+c, tdbSNP:61732969
775..777+(ggc)5, 6, 7dbSNP:72550890
775+a, gdbSNP:139909611
780+c, tdbSNP:140003720
789+c, tdbSNP:151073460
807+c, tdbSNP:149785330
819+c, tdbSNP:368618806
821+a, cdbSNP:145013063
869+g, tdbSNP:149076460
893+dbSNP:
893+a, gdbSNP:144917373
918+dbSNP:
918+a, cdbSNP:199745766
936+c, tdbSNP:138746304
938+dbSNP:
938+a, cdbSNP:370544127
954+c, tdbSNP:192350464
973+c, tdbSNP:387907274
1011+c, tdbSNP:140260536
complement(1076..1077)-, adbSNP:34752278
1119+a, gdbSNP:374933969
1185+dbSNP:
1185+c, tdbSNP:190724342
1191+c, tdbSNP:145232220
1212+c, tdbSNP:369894777
1256+a, gdbSNP:200292328
1261+a, cdbSNP:61733965
1293+dbSNP:
1293+c, gdbSNP:41292384
1300+g, tdbSNP:41292386
1302+g, tdbSNP:76570520
1314..1315+, gdbSNP:141251217
1345+a, gdbSNP:370295006
1353+c, tdbSNP:368780804
1397+c, tdbSNP:186547381
1422+dbSNP:
1422+c, tdbSNP:377010944
1453+c, tdbSNP:201533156
1489+c, tdbSNP:199674833
1499+a, gdbSNP:141684472
complement(1502)-, cdbSNP:35711706
1547+a, gdbSNP:111705357
1551+c, tdbSNP:112061837
1557+c, tdbSNP:372721739
1558+c, tdbSNP:201772423
1565+a, gdbSNP:201608365
1567+a, gdbSNP:200903051
1569+c, tdbSNP:150529460
1588+c, tdbSNP:387906627
complement(1589)-t, cdbSNP:11557276
1613+a, gdbSNP:10684
1625+a, gdbSNP:267606831
1635+a, gdbSNP:1132415
1648+dbSNP:
1648+a, gdbSNP:369757630
1656+c, gdbSNP:121909667
1658+a, gdbSNP:121909669
1666+c, g, tdbSNP:121909668
1667+a, gdbSNP:121909671
1671+a, gdbSNP:138901914
1675+a, tdbSNP:267606833
complement(1727)-t, g, cdbSNP:80301724
1734+a, gdbSNP:376510148
1861+c, gdbSNP:375615976
1862+c, tdbSNP:182573197
1900+c, tdbSNP:140875749
1989+c, tdbSNP:187266535
2021+g, tdbSNP:192206514
2036+a, gdbSNP:373271107
2100+a, tdbSNP:80269012
2114+c, tdbSNP:376223313
2143+a, gdbSNP:184638686
2164+c, tdbSNP:188934339
2177+g, tdbSNP:73530293
2247+c, tdbSNP:192705444
2250+c, tdbSNP:184121285
2312+a, gdbSNP:115626460
2345+g, tdbSNP:374258907
2365+a, gdbSNP:368791717
2417+c, tdbSNP:145145929
2456+c, gdbSNP:4889537
complement(2497)-, adbSNP:35061472
2534+a, gdbSNP:373470005
2596+c, tdbSNP:118018900
2675+c, tdbSNP:114772555
2712+a, gdbSNP:189491337
2720+c, tdbSNP:181164144
2738+c, tdbSNP:147581197
2775+a, gdbSNP:184277413
2830..2831+, acdbSNP:201043198
2831..2834+caga, gtdbSNP:386790284
2831..2832+, cadbSNP:371413829
2834+a, tdbSNP:140326191
2835+a, gdbSNP:189016242
2942+c, tdbSNP:367592148
2959+c, tdbSNP:371771617
2985+c, gdbSNP:142052066
3106+c, tdbSNP:73530295
3162+c, tdbSNP:11860134
3234+a, cdbSNP:181731798
3241+c, tdbSNP:151232336
3378+c, tdbSNP:187382003
3436+c, tdbSNP:191806441
3437+a, gdbSNP:140395401
3489+c, tdbSNP:16956408
complement(3492..3493)-, gdbSNP:35444115
3511+a, cdbSNP:12922585
3513+a, cdbSNP:12922587
3544+a, gdbSNP:150365928
3552..3554+, aacdbSNP:199804607
3554..3556+, caadbSNP:368975333
3618..3619+, gdbSNP:377640133
complement(3620)-t, gdbSNP:75995175
3657+a, gdbSNP:368307816
complement(3678)-c, adbSNP:146490489
3684+c, tdbSNP:182437252
3691+g, tdbSNP:140979886
3702+a, tdbSNP:145070922
3783+a, gdbSNP:372536910
3785+a, gdbSNP:370600518
3966+c, tdbSNP:185829316
4023+g, tdbSNP:138859808
4129+a, gdbSNP:189787862
4172+a, gdbSNP:73530298
4364+a, gdbSNP:116513340
4371+c, tdbSNP:71389498
4385+c, gdbSNP:182444257
4386+a, gdbSNP:187141416
4480+c, gdbSNP:17839571
4505+, tdbSNP:368576797
4542..4543+, tdbSNP:375892764
4558+g, tdbSNP:77728373
4633+c, tdbSNP:190455267
4641+a, gdbSNP:149361851
4674+c, tdbSNP:73530301
4707+a, tdbSNP:78368537
4709+a, tdbSNP:75091214
4791+a, tdbSNP:183045547
4840+a, cdbSNP:188668421
complement(4860)-c, adbSNP:3764324
4860+g, tdbSNP:386585772
4917+c, tdbSNP:193018950
4984+c, gdbSNP:184109677
5036+g, tdbSNP:187529579
Gene SymbolFUS
Gene SynonymALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS
Chromosome16
Locus Map16p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001170937 Homo sapiens FUS RNA binding protein (FUS), transcript variant 4, mRNA. On-demand $699.00 18
NM_001170634 Homo sapiens FUS RNA binding protein (FUS), transcript variant 3, mRNA. On-demand $699.00 18
NM_004960 Homo sapiens FUS RNA binding protein (FUS), transcript variant 1, mRNA. On-demand $699.00 18
XM_005255233 PREDICTED: Homo sapiens fused in sarcoma (FUS), transcript variant X3, mRNA. On-demand $549.00 14
Title ALS-associated mutation FUS-R521C causes DNA damage and RNA splicing defects .
Author Qiu,H., Lee,S., Shang,Y., Wang,W.Y., Au,K.F., Kamiya,S., Barmada,S.J., Finkbeiner,S., Lui,H., Carlton,C.E., Tang,A.A., Oldham,M.C., Wang,H., Shorter,J., Filiano,A.J., Roberson,E.D., Tourtellotte,W.G., Chen,B., Tsai,L.H. and Huang,E.J.
Journal J. Clin. Invest. 124 (3), 981-999 (2014)
Title Intranuclear aggregation of mutant FUS/TLS as a molecular pathomechanism of amyotrophic lateral sclerosis .
Author Nomura T, Watanabe S, Kaneko K, Yamanaka K, Nukina N and Furukawa Y.
Journal J. Biol. Chem. 289 (2), 1192-1202 (2014)
Title Interaction of FUS and HDAC1 regulates DNA damage response and repair in neurons .
Author Wang WY, Pan L, Su SC, Quinn EJ, Sasaki M, Jimenez JC, Mackenzie IR, Huang EJ and Tsai LH.
Journal Nat. Neurosci. 16 (10), 1383-1391 (2013)
Title Fused in sarcoma (FUS) protein lacking nuclear localization signal (NLS) and major RNA binding motifs triggers proteinopathy and severe motor phenotype in transgenic mice .
Author Shelkovnikova TA, Peters OM, Deykin AV, Connor-Robson N, Robinson H, Ustyugov AA, Bachurin SO, Ermolkevich TG, Goldman IL, Sadchikova ER, Kovrazhkina EA, Skvortsova VI, Ling SC, Da Cruz S, Parone PA, Buchman VL and Ninkina NN.
Journal J. Biol. Chem. 288 (35), 25266-25274 (2013)
Title The RNA-binding protein fused in sarcoma (FUS) functions downstream of poly(ADP-ribose) polymerase (PARP) in response to DNA damage .
Author Mastrocola AS, Kim SH, Trinh AT, Rodenkirch LA and Tibbetts RS.
Journal J. Biol. Chem. 288 (34), 24731-24741 (2013)
Title Characterization of the CHOP breakpoints and fusion transcripts in myxoid liposarcomas with the 12;16 translocation .
Author Panagopoulos I, Mandahl N, Ron D, Hoglund M, Nilbert M, Mertens F, Mitelman F and Aman P.
Journal Cancer Res. 54 (24), 6500-6503 (1994)
Title An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation .
Author Ichikawa H, Shimizu K, Hayashi Y and Ohki M.
Journal Cancer Res. 54 (11), 2865-2868 (1994)
Title Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma .
Author Rabbitts TH, Forster A, Larson R and Nathan P.
Journal Nat. Genet. 4 (2), 175-180 (1993)
Title Amyotrophic Lateral Sclerosis Overview .
Author Kinsley,L. and Siddique,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Localization of the chromosomal breakpoints of the t(12;16) in liposarcoma to subbands 12q13.3 and 16p11.2 .
Author Eneroth M, Mandahl N, Heim S, Willen H, Rydholm A, Alberts KA and Mitelman F.
Journal Cancer Genet. Cytogenet. 48 (1), 101-107 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.