• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_004992 Homo sapiens methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_004992.3, 160707948
Length 10241 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mRNA.
Product methyl-CpG-binding protein 2 isoform 1
Comment

Summary: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. [provided by RefSeq, Jul 2009].


Transcript Variant: This variant (1), also known as MECP2A, includes exon 2. Translation is reported to initiate in exon 2 resulting in a protein isoform (1) with a distinct N-terminus.

RefSeq NP_004983.1
CDS 227..1687
Misc Feature(1)176..178
Misc Feature(2)176..178
Misc Feature(3)464..466
Misc Feature(4)464..466
Misc Feature(5)464..466
Misc Feature(6)506..730
Misc Feature(7)order(545..547,551..553,557..559,581..583,587..589,
Misc Feature(8)572..574
Misc Feature(9)872..874
Misc Feature(10)1502..1504
Misc Feature(11)1571..1573
Exon (1)1..128
Gene:MECP2
Gene Synonym:AUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT
Exon (2)129..252
Gene:MECP2
Gene Synonym:AUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT
Exon (3)253..603
Gene:MECP2
Gene Synonym:AUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT
Exon (4)604..10241
Gene:MECP2
Gene Synonym:AUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT
Translation MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK APGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGAT TSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS PPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPR GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP VTERVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(71)-dbSNP:
complement(71)-t, cdbSNP:179363901
complement(212)-t, cdbSNP:267608324
complement(217)-t, cdbSNP:202057538
complement(227..252)-, atggtagctgggatgttagggctcagdbSNP:267608407
complement(227..228)-, adbSNP:267608408
complement(237..238)-, cdbSNP:34320032
complement(254)-dbSNP:
complement(254)-t, g, cdbSNP:61754421
complement(262)-g, cdbSNP:61754422
268..269+, agtcagaadbSNP:63749008
complement(272)-t, cdbSNP:61754424
complement(276..277)-, adbSNP:267608416
complement(281)-t, cdbSNP:61754425
complement(282..283)-, adbSNP:267608417
complement(290)-t, adbSNP:62641234
complement(302)-, cdbSNP:61754426
complement(317)-, gdbSNP:61754427
complement(326..329)-, gatadbSNP:61754428
complement(333..339)-, aagaagadbSNP:267608424
complement(333..334)-, aadbSNP:267608425
complement(334..337)-, agaadbSNP:267608426
complement(343..344)-, adbSNP:267608427
complement(345..346)-, agdbSNP:267608428
complement(352..353)-, gdbSNP:61754430
complement(361)-g, adbSNP:139477857
complement(366..367)-, adbSNP:61754431
complement(372)-g, c, adbSNP:61754432
complement(379)-g, cdbSNP:267608432
complement(381)-g, adbSNP:61754433
complement(393..394)-, ccdbSNP:267608434
complement(394)-t, cdbSNP:61754435
complement(415..416)-, gadbSNP:61754436
complement(420)-g, cdbSNP:61754437
complement(426)-c, adbSNP:150900180
complement(427)-, gdbSNP:61754438
complement(429)-g, cdbSNP:267608438
complement(436)-t, cdbSNP:61754439
complement(441..442)-, t, cdbSNP:61754441
complement(441)-t, cdbSNP:61754440
complement(450)-t, cdbSNP:267608440
complement(451)-g, adbSNP:61754442
complement(455..464)-, gcttctgcctdbSNP:63749009
complement(459)-, cdbSNP:267608442
complement(469..470)-, cdbSNP:267608443
complement(471)-g, adbSNP:61754444
complement(483)-g, cdbSNP:61754445
complement(484..485)-, cadbSNP:267608444
complement(499)-t, cdbSNP:200629699
complement(500)-t, gdbSNP:267608445
complement(501..502)-, gdbSNP:267608446
complement(502..503)-, gdbSNP:267608405
complement(502)-t, cdbSNP:140191561
complement(503)-t, cdbSNP:61754447
complement(505)-t, cdbSNP:267608447
complement(515)-t, gdbSNP:61754448
complement(517)-c, adbSNP:61754449
complement(521..523)-, accdbSNP:267608449
complement(523)-g, cdbSNP:61754450
complement(524)-g, cdbSNP:28935168
complement(525)-t, gdbSNP:61754451
complement(527)-t, cdbSNP:61754452
complement(528)-t, g, c, adbSNP:61754453
complement(534)-g, adbSNP:267608450
complement(536)-t, cdbSNP:267608451
complement(537..549)-, ggacacggaagctdbSNP:63749010
complement(537)-g, adbSNP:61754455
complement(541..542)-, adbSNP:61754456
complement(542)-t, g, cdbSNP:28934907
complement(543)-t, g, adbSNP:61754457
complement(549)-t, adbSNP:61754458
complement(552..553)-, adbSNP:267608452
complement(557)-g, adbSNP:61754459
complement(560)-t, adbSNP:267608398
complement(567)-g, cdbSNP:61755760
complement(569)-t, cdbSNP:267608388
complement(571)-, cdbSNP:61755761
complement(584)-t, gdbSNP:267608454
complement(588)-g, adbSNP:61755762
complement(590)-g, adbSNP:267608455
complement(591)-t, cdbSNP:267608456
complement(598)-t, g, cdbSNP:61755763
complement(601)-t, gdbSNP:146107517
complement(601)-, cdbSNP:267608457
complement(606)-dbSNP:
complement(606)-t, cdbSNP:267608387
complement(608)-t, cdbSNP:267608469
complement(609)-c, adbSNP:61748383
complement(612)-t, gdbSNP:61748384
complement(618)-c, adbSNP:267608470
complement(619)-g, cdbSNP:61748385
complement(623)-t, g, cdbSNP:28934904
complement(624)-t, g, adbSNP:61748389
complement(626)-t, cdbSNP:267608471
complement(627)-t, g, cdbSNP:61748390
complement(629)-g, adbSNP:61748391
complement(636)-g, adbSNP:61748392
complement(637)-, gdbSNP:61748393
complement(639)-t, c, adbSNP:267608475
complement(645)-t, cdbSNP:28934908
complement(646)-, gdbSNP:267608476
complement(648..649)-, adbSNP:61748394
complement(648)-g, adbSNP:61748395
complement(649)-g, c, adbSNP:61748396
complement(652)-t, cdbSNP:61748397
complement(654..655)-, tdbSNP:61748398
complement(656)-t, adbSNP:61748399
complement(657)-, adbSNP:61748400
complement(664)-t, cdbSNP:61748386
complement(665)-, gdbSNP:62952161
complement(665)-g, adbSNP:61748401
complement(677)-, gdbSNP:61748402
complement(678)-g, adbSNP:61748403
complement(680)-g, cdbSNP:179363900
complement(681)-g, cdbSNP:61748404
complement(689)-t, adbSNP:61748406
complement(690)-t, g, cdbSNP:28934905
complement(693)-g, c, adbSNP:61748407
complement(694)-t, g, cdbSNP:61748408
complement(695)-t, adbSNP:61748410
complement(696..697)-, tdbSNP:267608482
complement(696..697)-, tcdbSNP:267608483
complement(697)-g, cdbSNP:267608484
complement(698)-g, adbSNP:61748411
complement(699)-t, cdbSNP:28934906
complement(700)-g, adbSNP:61748413
complement(701)-, gdbSNP:267608485
complement(705)-g, cdbSNP:61748414
complement(706..707)-, tgdbSNP:267608486
complement(706)-, tdbSNP:61748415
complement(707)-t, gdbSNP:61748416
complement(708)-t, g, adbSNP:61748417
complement(709)-, gdbSNP:61748418
complement(710..711)-, adbSNP:267608487
complement(714..715)-, ggdbSNP:267608488
complement(721)-, cdbSNP:267608489
complement(725)-t, cdbSNP:61748420
complement(728)-t, cdbSNP:61748421
complement(734)-t, cdbSNP:61748425
complement(740)-t, cdbSNP:61748426
complement(741)-t, cdbSNP:267608491
complement(743)-g, cdbSNP:61748427
complement(744)-g, cdbSNP:267608492
complement(749)-t, adbSNP:61748428
complement(751..752)-, cdbSNP:62621666
complement(752)-g, adbSNP:186663314
complement(753)-g, cdbSNP:61749701
complement(754)-g, cdbSNP:61754420
complement(755)-t, adbSNP:61749702
complement(757)-, adbSNP:61749703
complement(764)-t, adbSNP:267608495
complement(768)-t, cdbSNP:61749705
complement(769..770)-, tcdbSNP:267608496
complement(773)-g, cdbSNP:61749706
complement(780)-, gdbSNP:61749707
complement(787)-t, gdbSNP:200074866
complement(792..793)-, gdbSNP:267608499
complement(792)-, gdbSNP:61749708
complement(793..794)-, adbSNP:61749709
complement(799)-t, cdbSNP:61749710
complement(800)-t, adbSNP:193922679
complement(808)-t, cdbSNP:61749711
complement(811)-t, cdbSNP:61749712
complement(813)-g, cdbSNP:61749713
complement(816)-t, cdbSNP:61749714
complement(817)-g, adbSNP:61749716
complement(818)-t, adbSNP:61749717
complement(822)-c, adbSNP:267608502
complement(824)-t, adbSNP:61749718
complement(827..828)-, gdbSNP:267608503
complement(828)-t, cdbSNP:61748381
complement(829)-g, adbSNP:267608504
complement(834..835)-, adbSNP:267608506
complement(834)-t, cdbSNP:61749720
complement(835)-g, adbSNP:61749722
complement(837..838)-ag, cadbSNP:267608507
complement(837)-g, cdbSNP:61749724
complement(839)-t, gdbSNP:61749726
complement(843)-, gdbSNP:61749727
complement(843)-g, c, adbSNP:63485860
complement(846..847)-, tdbSNP:61749728
complement(848)-t, cdbSNP:61749729
complement(855)-t, adbSNP:61749730
complement(856..859)-, aaggdbSNP:62621668
complement(857..883)-, agggtcctggagaaaagtcctgggaagdbSNP:267608508
complement(859)-g, cdbSNP:61749731
complement(861..881)-, tcctggagaaaagtcctgggadbSNP:267608509
complement(867..879)-, agaaaagtcctggdbSNP:267608386
complement(877..878)-, tgdbSNP:267608510
complement(880..883)-, gaagdbSNP:61749734
complement(886)-t, cdbSNP:267608512
complement(892)-g, cdbSNP:61749735
complement(899)-c, adbSNP:267608513
complement(900)-t, g, cdbSNP:61749715
complement(902..903)-, adbSNP:267608514
complement(903..904)-, adbSNP:61749736
complement(905)-g, cdbSNP:61749737
complement(909)-g, cdbSNP:61749738
complement(912)-t, c, adbSNP:61749739
complement(916)-c, adbSNP:61749740
complement(921..922)-, gdbSNP:267608516
complement(921)-, gdbSNP:63260260
complement(921)-g, cdbSNP:61748422
complement(922)-, cdbSNP:61749741
complement(927)-g, cdbSNP:138211345
complement(936..937)-, gdbSNP:267608517
complement(936)-t, gdbSNP:62846063
complement(936)-, gdbSNP:61749743
complement(941)-, gdbSNP:61749744
complement(943)-g, adbSNP:146981224
complement(946..947)-, cdbSNP:267608518
complement(946)-t, g, cdbSNP:61749746
complement(956)-t, cdbSNP:61749747
complement(960..985)-, tcatggtgatcaaacgccccggcaggdbSNP:267608519
complement(962..969)-atggtgat, gtgdbSNP:267608520
complement(962..963)-, atdbSNP:61749749
complement(965)-, gdbSNP:61749750
complement(974..979)-ggccg, cgccccdbSNP:61750225
974..975+, c, tdbSNP:61749752
complement(974)-g, adbSNP:141382970
complement(975)-g, adbSNP:61750227
complement(976)-tcaggaagctt, cdbSNP:267608521
complement(976)-t, c, adbSNP:61748424
977..978+, acgccdbSNP:61749751
complement(978)-t, cdbSNP:61750229
979..980+, c, ccdbSNP:267608522
complement(979)-t, cdbSNP:63582063
complement(979)-, cdbSNP:61750231
complement(981..982)-, gdbSNP:61750232
complement(981)-, gdbSNP:61750233
complement(982..985)-, caggdbSNP:267608523
complement(986)-t, adbSNP:63259763
989..990+, caggaagcdbSNP:61750235
complement(989)-t, cdbSNP:61749721
complement(1003)-t, cdbSNP:1042870
1005..1006+, aaagctgaggccgadbSNP:267608524
complement(1010)-t, cdbSNP:267608525
complement(1018..1019)-, tcdbSNP:267608526
complement(1021)-g, cdbSNP:267608527
complement(1025)-t, adbSNP:61750238
complement(1028)-t, cdbSNP:61750239
complement(1032)-, gdbSNP:61750241
complement(1034)-t, g, cdbSNP:61750240
complement(1034)-, cdbSNP:62931162
complement(1036..1039)-, aaagdbSNP:267608529
complement(1038..1044)-, agccgggdbSNP:61750242
complement(1041)-t, cdbSNP:61750243
complement(1042..1058)-, ggggagtgtggtggcagdbSNP:63749012
complement(1045)-t, gdbSNP:61750245
complement(1045)-, gdbSNP:267608530
complement(1050)-g, adbSNP:143989769
complement(1056)-, cdbSNP:61750247
complement(1060)-t, cdbSNP:61750248
complement(1062)-t, cdbSNP:61750249
complement(1066)-t, cdbSNP:61750251
complement(1069)-t, cdbSNP:61750252
complement(1075)-g, cdbSNP:61750253
complement(1076)-g, adbSNP:61750255
complement(1080..1081)-, adbSNP:267608531
complement(1082..1085)-, aaagdbSNP:61750256
complement(1083)-g, adbSNP:267608533
complement(1085)-g, cdbSNP:61750257
complement(1087)-g, adbSNP:139378224
complement(1090..1091)-, gdbSNP:267608535
complement(1091..1092)-, aadbSNP:267608536
complement(1091)-t, adbSNP:61750259
complement(1095..1096)-, adbSNP:267608538
complement(1097)-t, gdbSNP:61751360
complement(1100..1101)-, adbSNP:61751361
complement(1106..1110)-, cgatcdbSNP:61751364
complement(1106)-t, cdbSNP:61751362
complement(1107..1128)-, gatctgtgcaggagaccgtactdbSNP:267608540
complement(1107)-g, cdbSNP:61751366
complement(1109)-, tdbSNP:267608541
complement(1115)-t, cdbSNP:61751367
complement(1116..1201)-dbSNP:63749747
complement(1123)-t, cdbSNP:61748423
complement(1124..1130)-, gtactccdbSNP:267608543
complement(1124..1127)-, gtacdbSNP:62701461
complement(1124)-, gdbSNP:267608544
complement(1124)-g, adbSNP:61751370
complement(1126..1134)-, actccccatdbSNP:267608545
complement(1129)-t, cdbSNP:61751372
complement(1130)-t, g, c, adbSNP:61751373
complement(1131)-t, g, c, adbSNP:61749723
complement(1132)-g, cdbSNP:61751438
complement(1132)-, cdbSNP:267608548
complement(1134)-t, gdbSNP:267608549
complement(1135)-g, cdbSNP:61751439
complement(1136)-g, adbSNP:61751440
complement(1137)-g, adbSNP:267608550
complement(1139)-g, adbSNP:267608551
complement(1140)-g, adbSNP:61751441
complement(1142)-t, cdbSNP:28935468
complement(1143)-t, g, adbSNP:61751443
complement(1151)-t, cdbSNP:61751444
complement(1158)-t, cdbSNP:61751445
complement(1168)-t, cdbSNP:61751446
complement(1174)-g, cdbSNP:61751447
complement(1179)-c, adbSNP:61751448
complement(1180)-t, cdbSNP:141454727
complement(1190)-t, g, cdbSNP:61751449
complement(1191..1196)-, ccctgcdbSNP:61751452
complement(1191)-t, cdbSNP:61751450
complement(1208)-g, cdbSNP:267608556
complement(1210)-t, c, adbSNP:61751442
complement(1211)-t, cdbSNP:201871183
complement(1218..1220)-, agadbSNP:61751456
complement(1218)-g, adbSNP:267608557
complement(1220..1224)-, agcggdbSNP:267608558
complement(1222)-g, adbSNP:148744894
complement(1225)-t, gdbSNP:61751451
complement(1230..1263)-, gactgaagacctgtaagagccctgggcggaaaagdbSNP:267608376
complement(1235..1253)-, aagacctgtaagagccctgdbSNP:267608559
complement(1240)-t, cdbSNP:267608400
complement(1241)-t, cdbSNP:267608560
complement(1255..1256)-, gdbSNP:267608331
complement(1255)-, gdbSNP:61751457
complement(1256)-t, cdbSNP:61752361
complement(1261)-g, adbSNP:61752362
complement(1264)-g, cdbSNP:61752365
complement(1269..1282)-, agagcagccccaagdbSNP:267608380
complement(1274..1321)-dbSNP:267608562
complement(1277..1291)-, cccaaggggcgcagcdbSNP:267608384
complement(1277..1280)-, cccadbSNP:267608377
complement(1285..1298)-, gcgcagcagcagcgdbSNP:267608378
complement(1286)-g, adbSNP:143876280
complement(1287..1300)-, gcagcagcagcgccdbSNP:267608381
complement(1287)-t, g, adbSNP:61748387
complement(1291)-t, cdbSNP:267608563
complement(1295..1297)-, agcdbSNP:267608564
complement(1297)-t, cdbSNP:61750236
complement(1298)-t, cdbSNP:147017239
complement(1301)-t, cdbSNP:61752371
complement(1305)-c, adbSNP:61752372
complement(1307)-g, cdbSNP:61752373
complement(1313)-t, adbSNP:61752375
complement(1314..1341)-, agaaggagcaccaccaccatcaccaccadbSNP:267608385
complement(1325..1344)-, caccaccatcaccaccactcdbSNP:267608567
complement(1330..1332)-, ccadbSNP:61752381
complement(1330)-t, cdbSNP:61752382
complement(1331..1342)-, catcaccaccacdbSNP:267608371
complement(1331)-, cdbSNP:267608568
complement(1344)-g, cdbSNP:267608569
complement(1351..1363)-, cccaaaggcccccdbSNP:267608340
complement(1352)-t, cdbSNP:61752387
complement(1353..1363)-, caaaggcccccdbSNP:267608570
complement(1353)-g, cdbSNP:61752976
complement(1355..1359)-gagt, aaggcdbSNP:267608379
complement(1358..1385)-, gcccccgtgccactgctcccacccctgcdbSNP:267608348
complement(1359)-g, c, adbSNP:201314910
complement(1361..1368)-, cccgtgccdbSNP:267608571
complement(1362..1368)-, ccgtgccdbSNP:267608389
complement(1363)-t, cdbSNP:61752980
complement(1364..1389)-, gtgccactgctcccacccctgcccccdbSNP:267608382
complement(1364)-g, adbSNP:267608572
complement(1366)-t, cdbSNP:201711454
complement(1367)-g, cdbSNP:61752981
complement(1371..1420)-dbSNP:267608573
complement(1373..1402)-, ctcccacccctgcccccacctccacctgagdbSNP:267608350
complement(1376..1418)-, ccacccctgcccccacctccacctgagcccgagagctccgaggdbSNP:63749023
complement(1377..1417)-, cacccctgcccccacctccacctgagcccgagagctccgagdbSNP:63749024
complement(1377..1414)-, cacccctgcccccacctccacctgagcccgagagctccdbSNP:267608574
complement(1377..1409)-, cacccctgcccccacctccacctgagcccgagadbSNP:267608575
complement(1377)-t, cdbSNP:193922676
complement(1378..1421)-, acccctgcccccacctccacctgagcccgagagctccgaggaccdbSNP:267608372
complement(1378..1381)-, acccdbSNP:267608576
complement(1379..1416)-, cccctgcccccacctccacctgagcccgagagctccgadbSNP:267608577
complement(1380..1423)-, ccctgcccccacctccacctgagcccgagagctccgaggaccccdbSNP:267608579
complement(1380..1411)-, ccctgcccccacctccacctgagcccgagagcdbSNP:267608578
complement(1380)-g, adbSNP:111302745
complement(1381..1426)-, cctgcccccacctccacctgagcccgagagctccgaggaccccaccdbSNP:267608329
complement(1381..1409)-, cctgcccccacctccacctgagcccgagadbSNP:267608580
complement(1381..1398)-, cctgcccccacctccaccdbSNP:267608392
complement(1382..1426)-, ctgcccccacctccacctgagcccgagagctccgaggaccccaccdbSNP:267608581
complement(1382..1423)-, ctgcccccacctccacctgagcccgagagctccgaggaccccdbSNP:267608583
complement(1382..1398)-, ctgcccccacctccaccdbSNP:267608582
complement(1382)-t, cdbSNP:1042873
complement(1383..1426)-, tgcccccacctccacctgagcccgagagctccgaggaccccaccdbSNP:63749748
complement(1383..1425)-, tgcccccacctccacctgagcccgagagctccgaggaccccacdbSNP:267608587
complement(1383..1423)-, tgcccccacctccacctgagcccgagagctccgaggaccccdbSNP:267608327
complement(1383..1418)-, tgcccccacctccacctgagcccgagagctccgaggdbSNP:63749028
complement(1383..1417)-, tgcccccacctccacctgagcccgagagctccgagdbSNP:267608586
complement(1383..1414)-, tgcccccacctccacctgagcccgagagctccdbSNP:267608585
complement(1383..1413)-, tgcccccacctccacctgagcccgagagctcdbSNP:61754419
1383..1384+, ctdbSNP:267608584
complement(1384..1427)-, gcccccacctccacctgagcccgagagctccgaggaccccaccadbSNP:61752992
complement(1384..1426)-, gcccccacctccacctgagcccgagagctccgaggaccccaccdbSNP:63009262
complement(1384..1424)-, gcccccacctccacctgagcccgagagctccgaggaccccadbSNP:267608588
complement(1384..1412)-, gcccccacctccacctgagcccgagagctdbSNP:63749029
complement(1384..1393)-, gcccccacctdbSNP:63583161
complement(1385..1427)-, cccccacctccacctgagcccgagagctccgaggaccccaccadbSNP:63749030
complement(1385..1419)-, cccccacctccacctgagcccgagagctccgaggadbSNP:267608589
complement(1385..1400)-, cccccacctccacctgdbSNP:267608373
complement(1385..1386)-t, ccdbSNP:267608590
complement(1386..1426)-, ccccacctccacctgagcccgagagctccgaggaccccaccdbSNP:267608592
complement(1386..1414)-, ccccacctccacctgagcccgagagctccdbSNP:267608593
complement(1386..1411)-, ccccacctccacctgagcccgagagcdbSNP:267608591
complement(1386..1406)-, ccccacctccacctgagcccgdbSNP:267608594
complement(1386..1392)-, ccccaccdbSNP:267608595
complement(1386)-t, cdbSNP:63390262
complement(1387..1431)-cccacctccacctgagcccgagagctccgaggaccccaccagccc, adbSNP:267608596
complement(1387..1395)-, cccacctccdbSNP:267608401
complement(1387..1392)-, cccaccdbSNP:267608332
complement(1387..1389)-, cccdbSNP:267608339
complement(1387)-t, cdbSNP:61750246
complement(1388..1417)-, ccacctccacctgagcccgagagctccgagdbSNP:63749034
complement(1388..1405)-, ccacctccacctgagcccdbSNP:267608406
complement(1388..1389)-, ccdbSNP:267608598
complement(1388..1389)-cc, tadbSNP:267608597
complement(1388)-t, g, cdbSNP:61753000
complement(1389..1427)-, cacctccacctgagcccgagagctccgaggaccccaccadbSNP:267608602
complement(1389..1423)-, cacctccacctgagcccgagagctccgaggaccccdbSNP:267608599
complement(1389..1414)-, cacctccacctgagcccgagagctccdbSNP:267608600
complement(1389..1405)-, cacctccacctgagcccdbSNP:267608601
complement(1389..1399)-, cacctccacctdbSNP:267608334
complement(1389)-t, cdbSNP:61753006
complement(1390..1434)-, acctccacctgagcccgagagctccgaggaccccaccagccccccdbSNP:267608605
complement(1390..1433)-, acctccacctgagcccgagagctccgaggaccccaccagcccccdbSNP:63749749
complement(1390..1432)-, acctccacctgagcccgagagctccgaggaccccaccagccccdbSNP:267608603
complement(1390..1398)-, acctccaccdbSNP:267608604
complement(1390)-, adbSNP:267608606
complement(1391..1416)-, cctccacctgagcccgagagctccgadbSNP:267608607
complement(1393..1426)-, tccacctgagcccgagagctccgaggaccccaccdbSNP:267608343
complement(1393..1402)-, tccacctgagdbSNP:267608349
complement(1394..1399)-, ccacctdbSNP:61753008
complement(1395..1396)-, cadbSNP:267608608
complement(1396..1433)-, acctgagcccgagagctccgaggaccccaccagcccccdbSNP:267608609
complement(1399..1414)-, tgagcccgagagctccdbSNP:267608369
complement(1402..1419)-, gcccgagagctccgaggadbSNP:267608335
complement(1402)-g, adbSNP:61753009
complement(1404..1411)-, ccgagagcdbSNP:267608383
complement(1404)-t, cdbSNP:267608402
complement(1406..1431)-, gagagctccgaggaccccaccagcccdbSNP:267608333
complement(1406)-g, adbSNP:63094662
complement(1407..1417)-, agagctccgagdbSNP:267608403
complement(1411..1417)-, ctccgagdbSNP:63749018
complement(1415..1422)-, gaggacccdbSNP:267608338
complement(1415)-t, c, adbSNP:56268439
complement(1416..1417)-, adbSNP:267608610
complement(1420..1421)-, tdbSNP:61753011
complement(1422)-t, cdbSNP:62915962
complement(1423..1424)-, cdbSNP:267608612
complement(1423)-t, cdbSNP:61753012
complement(1426..1427)-, cdbSNP:267608613
complement(1428..1429)-, gdbSNP:267608614
complement(1428)-g, adbSNP:62707562
complement(1430)-t, gdbSNP:150146088
complement(1431)-t, cdbSNP:61753014
complement(1432)-t, cdbSNP:63586860
complement(1440..1456)-, cccaggacttgagcagcdbSNP:267608615
complement(1440)-t, cdbSNP:61753016
complement(1441)-t, cdbSNP:61753964
complement(1442)-t, cdbSNP:61753965
complement(1449..1491)-, tgagcagcagcgtctgcaaagaggagaagatgcccagaggaggdbSNP:63749038
complement(1455)-g, adbSNP:267608616
complement(1458..1466)-, gcgtctgcadbSNP:63749027
complement(1458..1462)-, gcgtcdbSNP:267608351
complement(1459)-g, adbSNP:3027928
complement(1460)-g, adbSNP:61753966
complement(1461..1486)-, tctgcaaagaggagaagatgcccagadbSNP:267608617
complement(1464..1492)-, gcaaagaggagaagatgcccagaggaggcdbSNP:267608374
complement(1465)-t, cdbSNP:61753967
complement(1476)-t, adbSNP:61753968
complement(1481)-g, adbSNP:140258520
complement(1483)-g, adbSNP:199540575
complement(1491..1515)-agcggccg, gctcactggagagcgacggctgcccdbSNP:63749064
complement(1492)-t, cdbSNP:61753970
complement(1504)-t, cdbSNP:267608619
complement(1508)-g, adbSNP:61753971
complement(1510)-t, cdbSNP:267608621
complement(1514)-t, cdbSNP:267608622
complement(1534..1535)-, tcdbSNP:61753972
complement(1541)-g, adbSNP:61753973
complement(1543)-t, cdbSNP:146632223
complement(1546..1547)-, tdbSNP:267608624
complement(1548..1556)-, ccaccgccgdbSNP:267608404
complement(1550..1590)-, accgccgccacggccgcagaaaagtacaaacaccgaggggadbSNP:267608625
complement(1550)-g, adbSNP:61753974
complement(1552)-t, cdbSNP:61751363
complement(1553)-g, adbSNP:193922677
complement(1556..1568)-, gccacggccgcagdbSNP:63749065
complement(1556)-g, adbSNP:61753975
complement(1561)-t, cdbSNP:3027927
complement(1565)-g, adbSNP:267608626
complement(1566)-t, cdbSNP:61753978
complement(1583)-t, cdbSNP:61753979
complement(1584)-g, adbSNP:61753980
complement(1589)-t, gdbSNP:104894864
complement(1590..1591)-, cdbSNP:267608627
complement(1598)-t, cdbSNP:267608628
complement(1599)-t, cdbSNP:185957513
complement(1622..1623)-, atdbSNP:267608630
complement(1629..1634)-, ggccaadbSNP:267608632
complement(1630)-g, adbSNP:267608633
complement(1641..1642)-, agdbSNP:267608634
complement(1645)-g, cdbSNP:75498268
complement(1656)-g, cdbSNP:267608328
complement(1659)-t, cdbSNP:145790362
complement(1662)-t, cdbSNP:267608635
complement(1664)-t, cdbSNP:267608636
complement(1667)-g, adbSNP:193922678
complement(1672)-t, cdbSNP:76895094
complement(1674..1716)-, agagagttagctgactttacacggagcggattgcaaagcaaacdbSNP:267608393
complement(1675)-g, cdbSNP:267608336
complement(1676..1699)-, agagttagctgactttacacggagdbSNP:267608637
complement(1676..1679)-, agagdbSNP:267608638
complement(1677)-g, cdbSNP:267608370
1679..1680+, agdbSNP:267608639
complement(1680..1683)-, ttagdbSNP:267608640
1682..1683+, tadbSNP:267608641
complement(1685)-t, cdbSNP:267608337
complement(1686)-t, gdbSNP:267608399
complement(1687)-g, c, adbSNP:267608642
complement(1695)-t, cdbSNP:267608330
complement(1696)-t, cdbSNP:144008995
complement(1701)-t, cdbSNP:199963992
complement(1707)-g, cdbSNP:202182246
complement(1712)-g, adbSNP:182066127
complement(1723)-g, cdbSNP:267608347
complement(1742)-g, cdbSNP:267608344
complement(1779)-t, g, cdbSNP:62621672
complement(1780)-g, adbSNP:267608326
complement(1785..1786)-, adbSNP:267608341
complement(1801)-g, adbSNP:189508671
complement(1809)-, tdbSNP:267608342
complement(1832)-t, cdbSNP:185048124
complement(1843)-c, adbSNP:73627291
complement(1864)-g, cdbSNP:267608345
complement(1881)-t, cdbSNP:3027926
complement(1891)-g, adbSNP:267608352
complement(1945)-g, cdbSNP:187969533
complement(1967)-c, adbSNP:183655599
complement(2015)-g, adbSNP:62621673
complement(2046)-g, cdbSNP:62621674
complement(2050)-g, cdbSNP:62621675
complement(2054)-t, cdbSNP:62620967
complement(2058)-g, cdbSNP:187851059
complement(2060)-t, cdbSNP:146407932
complement(2080)-g, adbSNP:267608361
complement(2103)-t, cdbSNP:141497603
complement(2174)-g, cdbSNP:267608325
complement(2176)-g, cdbSNP:111565519
complement(2195)-g, cdbSNP:144267471
complement(2216)-t, gdbSNP:267608362
complement(2219..2220)-, tdbSNP:34192817
complement(2231)-t, cdbSNP:183349022
complement(2241)-g, adbSNP:267608353
complement(2294)-t, cdbSNP:149593619
complement(2314)-t, cdbSNP:3027925
complement(2372)-g, cdbSNP:193185725
complement(2451)-g, cdbSNP:187932718
complement(2454)-t, gdbSNP:267608354
complement(2459)-t, cdbSNP:183441961
complement(2483..2509)-, acaaggtgcaggcaggctggcctggggdbSNP:267608375
complement(2493)-g, adbSNP:267608363
complement(2497)-c, adbSNP:190249595
complement(2507)-g, cdbSNP:185146054
complement(2517)-t, cdbSNP:182344920
complement(2518)-g, cdbSNP:190920575
complement(2548)-c, adbSNP:187614438
complement(2562..2563)-, adbSNP:267608364
complement(2565)-g, cdbSNP:3027924
complement(2591)-t, cdbSNP:181697351
complement(2751)-t, adbSNP:5987193
complement(2796)-g, adbSNP:190425483
complement(2805)-t, cdbSNP:186774570
complement(2821)-g, adbSNP:267608390
complement(2833)-g, cdbSNP:181130816
complement(2924)-t, cdbSNP:267608365
complement(2963)-g, adbSNP:2853337
complement(3007)-t, cdbSNP:188615745
complement(3055)-c, adbSNP:267608355
complement(3087)-g, cdbSNP:3027923
complement(3108)-c, adbSNP:140263878
complement(3129)-t, cdbSNP:2734645
complement(3197)-g, adbSNP:112674002
complement(3330)-g, adbSNP:41304986
complement(3403)-t, cdbSNP:191406252
complement(3424)-t, cdbSNP:3027922
complement(3492)-g, adbSNP:149055102
complement(3552)-t, cdbSNP:189253298
complement(3658)-c, adbSNP:112969322
complement(3914)-t, adbSNP:78543190
complement(4090)-g, cdbSNP:3813458
complement(4145)-t, cdbSNP:3813459
complement(4155)-t, cdbSNP:188469187
complement(4227)-g, adbSNP:185203012
complement(4233..4234)-, gdbSNP:201027377
complement(4243)-t, adbSNP:267608356
complement(4344)-t, cdbSNP:3027921
complement(4393)-g, adbSNP:267608357
complement(4643)-g, adbSNP:267608358
complement(4806)-g, adbSNP:28403628
complement(4886)-t, cdbSNP:201835353
complement(4964)-g, cdbSNP:2734644
complement(5126)-t, adbSNP:201029961
complement(5164)-t, cdbSNP:56036177
complement(5173)-g, cdbSNP:191660801
complement(5325)-t, cdbSNP:2734647
complement(5345)-t, cdbSNP:267608359
complement(5349)-g, adbSNP:267608366
complement(5403)-c, adbSNP:187250057
complement(5424)-g, cdbSNP:139849709
complement(5494)-t, cdbSNP:182188616
complement(5565)-g, cdbSNP:148230889
complement(5650)-g, adbSNP:188764327
complement(5748)-, adbSNP:35261581
complement(5773..5774)-, gtdbSNP:267608367
complement(6007)-c, adbSNP:183869736
complement(6031)-g, cdbSNP:150660702
complement(6084)-g, adbSNP:191997825
complement(6263)-t, gdbSNP:3027920
complement(6318)-t, cdbSNP:2734643
complement(6524)-g, adbSNP:186841969
complement(6550)-t, cdbSNP:181614505
complement(6853..6854)-, aadbSNP:200602554
complement(6888)-g, cdbSNP:190031183
complement(6935)-t, cdbSNP:185617517
complement(7035)-t, cdbSNP:267608346
complement(7078)-c, adbSNP:147495408
complement(7163)-t, adbSNP:180798692
complement(7174..7175)-, atdbSNP:202139104
complement(7310)-t, cdbSNP:200861195
complement(7328)-t, gdbSNP:61495057
complement(7526)-t, cdbSNP:267608368
complement(7537)-g, adbSNP:184353399
complement(7588)-t, cdbSNP:79615013
complement(7650)-g, adbSNP:182221808
complement(7740)-g, adbSNP:190444336
complement(8034)-g, cdbSNP:142948743
complement(8167)-g, cdbSNP:139053716
complement(8316)-t, cdbSNP:185164750
complement(8323)-g, cdbSNP:111782334
complement(8494)-g, adbSNP:192271039
complement(8609)-g, cdbSNP:3027919
complement(9067)-t, cdbSNP:41314155
complement(9121)-t, cdbSNP:187125270
complement(9145)-g, cdbSNP:12556178
complement(9204)-t, adbSNP:3027918
complement(9329)-c, adbSNP:144586717
complement(9435)-g, adbSNP:3027917
complement(9535)-g, adbSNP:3027916
complement(9543)-t, gdbSNP:3027915
complement(9637)-g, adbSNP:41299118
complement(9822)-t, cdbSNP:3027914
complement(9830)-t, adbSNP:3027913
complement(9847)-t, cdbSNP:3027912
complement(9904)-t, cdbSNP:7066787
complement(9948)-g, adbSNP:191797155
complement(10124)-g, adbSNP:3177341
complement(10187)-g, cdbSNP:267608391
complement(10189..10190)-, gdbSNP:57855075
complement(10190..10191)-, cdbSNP:267608396
complement(10190)-, cdbSNP:267608360
Gene SymbolMECP2
Gene SynonymAUTSX3; MRX16; MRX79; MRXS13; MRXSL; PPMX; RS; RTS; RTT
ChromosomeX
Locus MapXq28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001110792 Homo sapiens methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 2, mRNA. On-demand $699.00 18
NM_004992 Homo sapiens methyl CpG binding protein 2 (Rett syndrome) (MECP2), transcript variant 1, mRNA. On-demand $699.00 18
Title Human-specific regulation of MeCP2 levels in fetal brains by microRNA miR-483-5p .
Author Han,K., Gennarino,V.A., Lee,Y., Pang,K., Hashimoto-Torii,K., Choufani,S., Raju,C.S., Oldham,M.C., Weksberg,R., Rakic,P., Liu,Z. and Zoghbi,H.Y.
Journal Genes Dev. 27 (5), 485-490 (2013)
Title An AT-hook domain in MeCP2 determines the clinical course of Rett syndrome and related disorders .
Author Baker,S.A., Chen,L., Wilkins,A.D., Yu,P., Lichtarge,O. and Zoghbi,H.Y.
Journal Cell 152 (5), 984-996 (2013)
Title Spectrum of MECP2 gene mutations in a cohort of Indian patients with Rett syndrome: report of two novel mutations .
Author Das,D.K., Raha,S., Sanghavi,D., Maitra,A. and Udani,V.
Journal Gene 515 (1), 78-83 (2013)
Title Sequence variants within exon 1 of MECP2 occur in females with mental retardation .
Author Harvey,C.G., Menon,S.D., Stachowiak,B., Noor,A., Proctor,A., Mensah,A.K., Mnatzakanian,G.N., Alfred,S.E., Guo,R., Scherer,S.W., Kennedy,J.L., Roberts,W., Srivastava,A.K., Minassian,B.A. and Vincent,J.B.
Journal Am. J. Med. Genet. B Neuropsychiatr. Genet. 144B (3), 355-360 (2007)
Title Mechanisms of disease: neurogenetics of MeCP2 deficiency .
Author Francke,U.
Journal Nat Clin Pract Neurol 2 (4), 212-221 (2006)
Title A previously unidentified MECP2 open reading frame defines a new protein isoform relevant to Rett syndrome .
Author Mnatzakanian,G.N., Lohi,H., Munteanu,I., Alfred,S.E., Yamada,T., MacLeod,P.J., Jones,J.R., Scherer,S.W., Schanen,N.C., Friez,M.J., Vincent,J.B. and Minassian,B.A.
Journal Nat. Genet. 36 (4), 339-341 (2004)
Title Comparative sequence analysis of the MECP2-locus in human and mouse reveals new transcribed regions .
Author Reichwald,K., Thiesen,J., Wiehe,T., Weitzel,J., Poustka,W.A., Rosenthal,A., Platzer,M., Stratling,W.H. and Kioschis,P.
Journal Mamm. Genome 11 (3), 182-190 (2000)
Title Isolation, physical mapping, and northern analysis of the X-linked human gene encoding methyl CpG-binding protein, MECP2 .
Author D'Esposito,M., Quaderi,N.A., Ciccodicola,A., Bruni,P., Esposito,T., D'Urso,M. and Brown,S.D.
Journal Mamm. Genome 7 (7), 533-535 (1996)
Title The methyl-CpG binding protein MeCP2 is essential for embryonic development in the mouse .
Author Tate,P., Skarnes,W. and Bird,A.
Journal Nat. Genet. 12 (2), 205-208 (1996)
Title Purification, sequence, and cellular localization of a novel chromosomal protein that binds to methylated DNA .
Author Lewis,J.D., Meehan,R.R., Henzel,W.J., Maurer-Fogy,I., Jeppesen,P., Klein,F. and Bird,A.
Journal Cell 69 (6), 905-914 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.