• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein kinase, X-linked (PRKX), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005044 Homo sapiens protein kinase, X-linked (PRKX), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_005044.4, 290648026
Length 6084 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein kinase, X-linked (PRKX), mRNA.
Product cAMP-dependent protein kinase catalytic subunit PRKX
Comment

Summary: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination between this gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes of this gene are found on chromosomes X, 15 and Y. [provided by RefSeq, Feb 2010].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005035.1
CDS 382..1458
Misc Feature(1)193..195
Misc Feature(2)496..1455
Misc Feature(3)496..1455
Misc Feature(4)520..1392
Misc Feature(5)order(544..564,568..570,607..609,613..615,709..711,
Misc Feature(6)order(547..564,568..570,607..609,613..615,643..645,
Misc Feature(7)order(550..552,556..561,643..651,778..780,784..786,
Misc Feature(8)order(550..552,556..558,646..651,655..660,778..780,
Misc Feature(9)946..1008
Exon (1)1..547
Gene:PRKX
Gene Synonym:PKX1
Exon (2)548..716
Gene:PRKX
Gene Synonym:PKX1
Exon (3)717..980
Gene:PRKX
Gene Synonym:PKX1
Exon (4)981..1100
Gene:PRKX
Gene Synonym:PKX1
Exon (5)1101..1196
Gene:PRKX
Gene Synonym:PKX1
Exon (6)1197..1254
Gene:PRKX
Gene Synonym:PKX1
Exon (7)1255..1332
Gene:PRKX
Gene Synonym:PKX1
Exon (8)1333..1481
Gene:PRKX
Gene Synonym:PKX1
Exon (9)1482..6084
Gene:PRKX
Gene Synonym:PKX1
Translation MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTF GRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDER FLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILL DRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSG FPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHH RWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(54)-dbSNP:
complement(54)-t, gdbSNP:7053884
complement(56)-g, cdbSNP:7053882
complement(153)-g, adbSNP:59479399
complement(482)-t, cdbSNP:2012597
complement(509)-g, adbSNP:3752362
complement(558)-dbSNP:
complement(558)-c, adbSNP:56037462
complement(561)-g, adbSNP:113011308
complement(630)-g, adbSNP:10871864
complement(633)-g, adbSNP:148463199
complement(735)-dbSNP:
complement(735)-t, cdbSNP:2228657
complement(736)-t, cdbSNP:200883737
complement(738)-t, cdbSNP:200360871
complement(740)-t, cdbSNP:199909092
complement(749)-t, cdbSNP:199549061
complement(757)-t, cdbSNP:146239086
complement(765)-g, adbSNP:201001911
complement(771)-t, cdbSNP:143341482
complement(774)-g, adbSNP:139877964
complement(797)-t, cdbSNP:145956134
complement(815)-g, cdbSNP:200188843
complement(944)-g, adbSNP:200688274
complement(1044)-dbSNP:
complement(1044)-g, adbSNP:149460821
complement(1075)-t, cdbSNP:180881700
complement(1110)-dbSNP:
complement(1110)-t, cdbSNP:191011332
complement(1128)-t, cdbSNP:186611906
complement(1218)-dbSNP:
complement(1218)-g, adbSNP:137900398
complement(1283)-dbSNP:
complement(1283)-t, cdbSNP:150699468
complement(1291)-g, adbSNP:141998823
complement(1296)-t, cdbSNP:2302751
complement(1316)-g, adbSNP:138517585
complement(1323)-t, cdbSNP:147093558
complement(1341)-dbSNP:
complement(1341)-g, adbSNP:141700607
complement(1342)-t, cdbSNP:139150166
complement(1362)-g, adbSNP:146727237
complement(1363)-t, cdbSNP:45588733
complement(1366)-t, cdbSNP:141993152
complement(1413)-g, adbSNP:200967884
complement(1415)-g, adbSNP:149150830
complement(1419)-g, adbSNP:145173948
complement(1424)-g, adbSNP:149966538
complement(1463..1464)-, ctdbSNP:10585099
complement(1613)-c, adbSNP:1056367
complement(1803..1804)-, cadbSNP:61451564
complement(1841..1848)-, acacacacdbSNP:202024071
complement(1843)-, cacacacadbSNP:57960952
complement(1861)-t, adbSNP:143155318
complement(1893)-t, gdbSNP:12838512
complement(1931)-g, adbSNP:111589474
complement(2089)-t, gdbSNP:1056368
complement(2094)-g, adbSNP:188002927
complement(2099)-t, gdbSNP:1056369
complement(2143)-g, adbSNP:184793455
complement(2207)-t, adbSNP:1056370
complement(2264)-t, cdbSNP:188206617
complement(2296)-t, cdbSNP:183280122
complement(2448)-t, cdbSNP:191361351
complement(2516)-t, cdbSNP:186963368
complement(2548)-, tdbSNP:66607852
complement(2591)-g, adbSNP:141092572
complement(2627)-t, cdbSNP:147772326
complement(2630)-g, adbSNP:144263221
complement(2702)-g, adbSNP:12398927
complement(2791)-c, adbSNP:151294728
complement(2850)-t, cdbSNP:142423042
complement(2997)-t, cdbSNP:73438411
complement(3026)-g, adbSNP:182302366
complement(3038)-t, g, adbSNP:189615542
complement(3062)-c, adbSNP:186339585
complement(3067)-g, cdbSNP:181758607
complement(3369)-t, cdbSNP:12851759
complement(3405)-t, cdbSNP:113803483
complement(3498)-g, adbSNP:191889509
complement(3602)-t, cdbSNP:144376546
complement(3728..3729)-, cadbSNP:58430369
complement(3729..3730)-, acdbSNP:74406660
complement(3865)-t, cdbSNP:6567570
complement(3899)-g, adbSNP:41304687
complement(3975)-t, cdbSNP:6420576
complement(3979)-g, adbSNP:186970665
complement(4002)-t, cdbSNP:181811257
complement(4090)-t, cdbSNP:41302619
complement(4144)-t, cdbSNP:112145195
complement(4159)-t, cdbSNP:6567569
complement(4190)-t, cdbSNP:150135785
complement(4221)-g, adbSNP:55685921
complement(4224)-g, cdbSNP:56207330
complement(4235)-t, gdbSNP:41311457
complement(4252)-t, gdbSNP:41311463
complement(4262)-c, adbSNP:41311461
complement(4270)-g, adbSNP:41311455
complement(4285)-g, adbSNP:55866215
complement(4293)-t, gdbSNP:55824944
complement(4295)-t, cdbSNP:55806946
complement(4314)-g, adbSNP:41302617
complement(4318)-t, gdbSNP:41305153
complement(4341)-t, cdbSNP:189729885
complement(4342)-g, adbSNP:56203095
complement(4343)-g, adbSNP:55782495
complement(4348)-c, adbSNP:56351633
complement(4350)-t, cdbSNP:56080206
complement(4356)-t, cdbSNP:56206338
complement(4359)-c, adbSNP:55800573
complement(4381)-g, cdbSNP:41302615
complement(4390)-t, adbSNP:41297273
complement(4397)-t, cdbSNP:41304701
complement(4423)-t, cdbSNP:41304703
complement(4432)-t, cdbSNP:41297275
complement(4491)-g, cdbSNP:41305157
complement(4511)-g, cdbSNP:28491694
complement(4539)-t, cdbSNP:184081622
complement(4542)-t, cdbSNP:180947327
complement(4571)-g, adbSNP:1056371
complement(4581)-g, adbSNP:1056372
complement(4614)-g, adbSNP:143578489
complement(4637)-t, cdbSNP:1056373
complement(4679)-t, cdbSNP:7891173
complement(4744)-t, cdbSNP:1056376
complement(4796)-g, adbSNP:188149880
complement(4822..4823)-, tdbSNP:199604681
complement(4865)-g, cdbSNP:28726118
complement(4885)-t, cdbSNP:113140620
complement(4894)-g, cdbSNP:1056380
complement(4935)-g, adbSNP:6641586
complement(4948)-g, adbSNP:6641797
complement(4995)-g, adbSNP:28402878
complement(4997)-t, gdbSNP:28529071
complement(5072)-c, adbSNP:12836361
complement(5096)-g, adbSNP:184945500
complement(5259)-t, gdbSNP:45536032
complement(5280)-g, cdbSNP:1056384
complement(5290)-g, adbSNP:45554731
complement(5368)-c, adbSNP:12399381
complement(5552)-t, cdbSNP:193005260
complement(5555)-t, cdbSNP:151093156
complement(5626)-g, cdbSNP:113938848
complement(5709)-t, cdbSNP:144499324
complement(5756)-t, cdbSNP:190617062
complement(5798)-t, cdbSNP:1056388
complement(5833)-t, cdbSNP:185320121
complement(5880..5881)-, tggdbSNP:71875921
complement(5929..5932)-, acagdbSNP:200048376
complement(5929)-, gacdbSNP:72114660
complement(5969)-g, adbSNP:193072520
complement(5979)-t, gdbSNP:187101090
complement(6026)-c, adbSNP:182422397
Gene SymbolPRKX
Gene SynonymPKX1
ChromosomeX
Locus MapXp22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005044 Homo sapiens protein kinase, X-linked (PRKX), mRNA. On-demand $549.00 14
Title PRKX, TTBK2 and RSK4 expression causes Sunitinib resistance in kidney carcinoma- and melanoma-cell lines .
Author Bender,C. and Ullrich,A.
Journal Int. J. Cancer 131 (2), E45-E55 (2012)
Title MBD 4--a potential substrate for protein kinase X .
Author Lin,Y. and Li,W.
Journal Acta Biochim. Biophys. Sin. (Shanghai) 43 (11), 916-917 (2011)
Title PRKX critically regulates endothelial cell proliferation, migration, and vascular-like structure formation .
Author Li,X., Iomini,C., Hyink,D. and Wilson,P.D.
Journal Dev. Biol. 356 (2), 475-485 (2011)
Title Gene conversion between the X chromosome and the male-specific region of the Y chromosome at a translocation hotspot .
Author Rosser,Z.H., Balaresque,P. and Jobling,M.A.
Journal Am. J. Hum. Genet. 85 (1), 130-134 (2009)
Title Protein kinase X (PRKX) can rescue the effects of polycystic kidney disease-1 gene (PKD1) deficiency .
Author Li,X., Burrow,C.R., Polgar,K., Hyink,D.P., Gusella,G.L. and Wilson,P.D.
Journal Biochim. Biophys. Acta 1782 (1), 1-9 (2008)
Title PrKX is a novel catalytic subunit of the cAMP-dependent protein kinase regulated by the regulatory subunit type I .
Author Zimmermann,B., Chiorini,J.A., Ma,Y., Kotin,R.M. and Herberg,F.W.
Journal J. Biol. Chem. 274 (9), 5370-5378 (1999)
Title A lineage-specific protein kinase crucial for myeloid maturation .
Author Semizarov,D., Glesne,D., Laouar,A., Schiebel,K. and Huberman,E.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (26), 15412-15417 (1998)
Title Abnormal XY interchange between a novel isolated protein kinase gene, PRKY, and its homologue, PRKX, accounts for one third of all (Y+)XX males and (Y-)XY females .
Author Schiebel,K., Winkelmann,M., Mertz,A., Xu,X., Page,D.C., Weil,D., Petit,C. and Rappold,G.A.
Journal Hum. Mol. Genet. 6 (11), 1985-1989 (1997)
Title FISH localization of the human Y-homolog of protein kinase PRKX (PRKY) to Yp11.2 and two pseudogenes to 15q26 and Xq12-->q13 .
Author Schiebel,K., Mertz,A., Winkelmann,M., Glaser,B., Schempp,W. and Rappold,G.
Journal Cytogenet. Cell Genet. 76 (1-2), 49-52 (1997)
Title The human protein kinase gene PKX1 on Xp22.3 displays Xp/Yp homology and is a site of chromosomal instability .
Author Klink,A., Schiebel,K., Winkelmann,M., Rao,E., Horsthemke,B., Ludecke,H.J., Claussen,U., Scherer,G. and Rappold,G.
Journal Hum. Mol. Genet. 4 (5), 869-878 (1995)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.