• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens reelin (RELN), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22578 Homo sapiens reelin (RELN), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu22578C Homo sapiens reelin (RELN), transcript variant 1, mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005045.3, 223718138
Length 10383 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens reelin (RELN), transcript variant 1, mRNA.
Product reelin isoform a precursor
Comment

Summary: This gene encodes a large secreted extracellular matrix protein thought to control cell-cell interactions critical for cell positioning and neuronal migration during brain development. This protein may be involved in schizophrenia, autism, bipolar disorder, major depression and in migration defects associated with temporal lobe epilepsy. Mutations of this gene are associated with autosomal recessive lissencephaly with cerebellar hypoplasia. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript, and encodes the longer isoform (a).


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_005036.2
CDS 161..10543
Misc Feature(1)302..694
Misc Feature(2)764..1213
Misc Feature(3)1421..1828
Misc Feature(4)1736..2173
Misc Feature(5)order(1772..1777,1826..1831,1835..1837,1847..1858,
Misc Feature(6)order(1871..1873,1877..1879,2060..2062,2165..2167,
Misc Feature(7)order(1916..1918,1979..1981,1985..1990,2033..2035,
Misc Feature(8)1934..1969
Misc Feature(9)2282..2746
Misc Feature(10)order(2288..2290,2294..2296,2462..2467,2471..2473,
Misc Feature(11)order(2348..2350,2417..2422,2546..2548,2552..2554,
Misc Feature(12)order(2441..2443,2564..2569,2573..2575)
Misc Feature(13)2552..2587
Misc Feature(14)2759..3262
Misc Feature(15)order(2810..2815,2891..2896,2900..2902,2912..2923,
Misc Feature(16)order(2939..2941,2945..2947,3137..3139,3242..3244,
Misc Feature(17)order(2993..2995,3056..3058,3062..3067,3110..3112,
Misc Feature(18)3011..3046
Misc Feature(19)3260..3337
Misc Feature(20)3353..3820
Misc Feature(21)order(3362..3364,3368..3370,3542..3547,3551..3553,
Misc Feature(22)order(3419..3421,3497..3502,3620..3622,3626..3628,
Misc Feature(23)order(3521..3523,3638..3643,3647..3649)
Misc Feature(24)3626..3661
Misc Feature(25)3878..4387
Misc Feature(26)order(3929..3934,4010..4015,4019..4021,4031..4042,
Misc Feature(27)order(4058..4060,4064..4066,4268..4270,4379..4381,
Misc Feature(28)order(4106..4108,4169..4171,4175..4180,4241..4243,
Misc Feature(29)4124..4159
Misc Feature(30)4499..4951
Misc Feature(31)order(4505..4507,4511..4513,4670..4675,4679..4681,
Misc Feature(32)order(4556..4558,4625..4630,4754..4756,4760..4762,
Misc Feature(33)order(4649..4651,4772..4777,4781..4783)
Misc Feature(34)4760..4795
Misc Feature(35)4973..5482
Misc Feature(36)order(5021..5026,5099..5104,5108..5110,5120..5131,
Misc Feature(37)order(5147..5149,5153..5155,5339..5341,5447..5449,
Misc Feature(38)order(5195..5197,5258..5260,5264..5269,5297..5299,
Misc Feature(39)5213..5248
Misc Feature(40)5558..6007
Misc Feature(41)order(5567..5569,5573..5575,5738..5743,5747..5749,
Misc Feature(42)order(5621..5623,5693..5698,5801..5803,5807..5809,
Misc Feature(43)order(5717..5719,5819..5824,5828..5830)
Misc Feature(44)5807..5842
Misc Feature(45)6026..6550
Misc Feature(46)order(6071..6076,6170..6175,6179..6181,6191..6202,
Misc Feature(47)order(6218..6220,6224..6226,6425..6427,6539..6541,
Misc Feature(48)order(6224..6226,6257..6265,6329..6331,6377..6385,
Misc Feature(49)6284..6319
Misc Feature(50)6566..6637
Misc Feature(51)6653..7102
Misc Feature(52)order(6662..6664,6668..6670,6830..6835,6839..6841,
Misc Feature(53)order(6716..6718,6785..6790,6899..6901,6905..6907,
Misc Feature(54)order(6809..6811,6917..6922,6926..6928)
Misc Feature(55)6905..6940
Misc Feature(56)7124..7594
Misc Feature(57)order(7166..7171,7241..7246,7250..7252,7262..7273,
Misc Feature(58)order(7190..7192,7229..7234,7322..7324,7559..7561,
Misc Feature(59)order(7289..7291,7295..7297,7478..7480,7586..7588,
Misc Feature(60)order(7334..7336,7397..7399,7403..7408,7451..7453,
Misc Feature(61)7352..7387
Misc Feature(62)7700..8143
Misc Feature(63)order(7709..7711,7715..7717,7877..7882,7886..7888,
Misc Feature(64)order(7763..7765,7832..7837,7943..7945,7949..7951,
Misc Feature(65)order(7856..7858,7961..7966,7970..7972)
Misc Feature(66)7949..7984
Misc Feature(67)8165..8719
Misc Feature(68)order(8294..8299,8372..8377,8381..8383,8393..8404,
Misc Feature(69)order(8420..8422,8426..8428,8612..8614,8711..8713,
Misc Feature(70)order(8471..8473,8534..8536,8540..8545,8576..8578,
Misc Feature(71)8489..8524
Misc Feature(72)8825..9310
Misc Feature(73)order(8831..8833,8837..8839,9002..9007,9011..9013,
Misc Feature(74)order(8888..8890,8957..8962,9086..9088,9092..9094,
Misc Feature(75)order(8981..8983,9104..9109,9113..9115)
Misc Feature(76)9092..9127
Misc Feature(77)9323..9847
Misc Feature(78)order(9380..9385,9467..9472,9476..9478,9488..9499,
Misc Feature(79)order(9515..9517,9521..9523,9728..9730,9836..9838,
Misc Feature(80)order(9566..9568,9632..9634,9638..9643,9686..9688,
Misc Feature(81)9584..9622
Misc Feature(82)9956..10438
Misc Feature(83)order(9962..9964,9968..9970,10142..10147,10151..10153,
Misc Feature(84)order(10019..10021,10097..10102,10238..10240,10244..10246,
Misc Feature(85)order(10121..10123,10256..10261,10265..10267)
Misc Feature(86)10244..10279
Exon (1)1..386
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (2)387..497
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (3)498..633
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (4)634..704
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (5)705..737
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (6)738..816
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (7)817..913
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (8)914..965
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (9)966..1062
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (10)1063..1303
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (11)1304..1449
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (12)1450..1601
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (13)1602..1714
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (14)1715..1923
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (15)1924..2052
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (16)2053..2162
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (17)2163..2229
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (18)2230..2463
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (19)2464..2625
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (20)2626..2862
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (21)2863..3055
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (22)3056..3168
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (23)3169..3306
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (24)3307..3493
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (25)3494..3699
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (26)3700..3871
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (27)3872..4072
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (28)4073..4305
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (29)4306..4463
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (30)4464..4671
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (31)4672..4748
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (32)4749..4907
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (33)4908..5096
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (34)5097..5370
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (35)5371..5511
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (36)5512..5689
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (37)5690..5774
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (38)5775..5957
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (39)5958..6129
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (40)6130..6232
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (41)6233..6462
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (42)6463..6683
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (43)6684..6831
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (44)6832..7090
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (45)7091..7340
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (46)7341..7509
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (47)7510..7650
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (48)7651..7828
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (49)7829..8022
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (50)8023..8279
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (51)8280..8434
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (52)8435..8649
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (53)8650..8827
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (54)8828..9003
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (55)9004..9110
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (56)9111..9353
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (57)9354..9529
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (58)9530..9603
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (59)9604..9765
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (60)9766..9923
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (61)9924..10143
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (62)10144..10341
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (63)10342..10440
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (64)10441..10446
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Exon (65)10447..11571
Gene:RELN
Gene Synonym:LIS2; PRO1598; RL
Translation MERSGWARQTFLLALLLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLH IAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVQASQSIGGSSAFGFGIMSDHQF GNQFMCSVVASHVSHLPTTNLSFIWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQ GAPTDVTVHPHLAEIHSDSIILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIMHGNAV TFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSIIVLYAKNNSADWIQLEKI RAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILIINSAHRQVVL EDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQW SEEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNLRFYFVM GGICDPGNSHENDIILYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTPATKFCL RQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGRS WSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRNTRIRWRQTGPILG NMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSSRL SSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSKS VLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLSYHEPRIISVELPGDAKQFGIQFR WWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTL CFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTW HLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVIVLLPQKTWSSATRFRWSQSYYTAQD EWALDSIYIGQQCPNMCSGHGSCDHGICRCDQGYQGTECHPEAALPSTIMSDFENQNGWE SDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGES ASCNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRWW QPVFSGEDYDQWAVDDIIILSEKQKQIIPVINPTLPQNFYEKPAFDYPMNQMSVWLMLAN EGMVKNETFCAATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCANQFSSTAPVL LQYSHDAGMSWFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITIVIPRSLA SSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGTC VSNVPNHNEMFDRFEGKLSPLWYKITGAQVGTGCGTLNDGKSLYFNGPGKREARTVPLDT RNIRLVQFYIQIGSKTSGITCIKPRTRNEGLIVQYSNDNGILWHLLRELDFMSFLEPQII SIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANW YRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKPFSNSH SVQLQYSLNNGKDWHLVTEECVPPTIGCLHYTESSIYTSERFQNWKRITVYLPLSTISPR TRFRWIQANYTVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGPYCVPVVPL PSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTNTM YVQFSLRFIAKSTPERSHSILLQFSISGGITWHLMDEFYFPQTTNILFINVPLPYTAQTN ATRFRLWQPYNNGKKEEIWIVDDFIIDGNNVNNPVMLLDTFDFGPREDNWFFYPGGNIGL YCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFEINVGCSTDSSSADPVR LEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTMQGWRREVVHFGKLHLC GSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGQGSCINGTKCICDPGYSGPTCK ISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLMTRDLDL SHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEI PLKARSGSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFTTLDSRKWLLHPG GTKMPVCGSTGDALVFIEKASTRYVVSTDVAVNEDSFLQIDFAASCSVTDSCYAIELEYS VDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPPYTRSQATRFRWHQ PAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIQGNCVCDEQWGGLYCDDPETSLPTQLKD NFNRAPSSQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEFIQFYFM YGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIATRFRW WQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFDMF MEDKTSVNEHWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTEGWIMQFKIS VGCKVSEKIAQNQIHVQYSTDFGVSWNYLVPQCLPADPKCSGSVSQPSVFFPTKGWKRIT YPLPESLVGNPVRFRFYQKYSDMQWAIDNFYLGPGCLDNCRGHGDCLREQCICDPGYSGP NCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGSTVRQAVTQ DLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGITWTLLHEMDYQKYIS VRHDYILLPEDALTNTTRLRWWQPFVISNGIVVSGVERAQWALDNILIGGAEINPSQLVD TFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMM QFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATIY NSVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHGY CTTGAICICDESFQGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGVIGSGCGQLAP YAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSMSQTDSCNSDLSGPHAVDKAVL LQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWAL DHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
133..134+, cdbSNP:71154386
complement(134..135)-, cgccgc, cgccgccgccgccgccgcdbSNP:55656324
complement(186)-t, gdbSNP:115165703
complement(200)-t, cdbSNP:147551940
complement(219)-g, adbSNP:145135688
complement(225)-c, adbSNP:139532757
complement(228)-g, adbSNP:370745351
complement(237)-g, adbSNP:144557847
complement(273)-t, adbSNP:149715692
complement(287)-t, gdbSNP:369522512
complement(290)-g, cdbSNP:375165806
complement(299)-t, cdbSNP:139648092
complement(314)-g, cdbSNP:372475867
complement(349)-t, gdbSNP:370805443
complement(390)-dbSNP:
complement(390)-g, adbSNP:150587706
complement(405)-g, adbSNP:368049573
complement(406)-g, cdbSNP:113242008
complement(494)-g, adbSNP:201754586
complement(557)-dbSNP:
complement(557)-t, cdbSNP:200611900
complement(576)-g, cdbSNP:79471015
complement(584)-t, cdbSNP:376843378
complement(605)-g, cdbSNP:374263472
complement(685)-dbSNP:
complement(685)-g, cdbSNP:369997646
complement(725)-dbSNP:
complement(725)-g, adbSNP:115806540
complement(736)-t, cdbSNP:142874980
complement(781)-dbSNP:
complement(781)-g, adbSNP:114627891
complement(813)-g, adbSNP:374181862
complement(833)-dbSNP:
complement(833)-c, adbSNP:371731772
complement(845)-t, cdbSNP:368080418
complement(857)-t, cdbSNP:181961566
complement(858)-g, adbSNP:371936391
complement(877)-g, adbSNP:368472328
complement(878)-t, cdbSNP:375141725
complement(908)-t, cdbSNP:199961531
complement(964)-dbSNP:
complement(964)-g, adbSNP:369980828
complement(967)-dbSNP:
complement(967)-c, adbSNP:374420536
complement(981)-t, cdbSNP:143781910
991+c, tdbSNP:398124192
complement(1010)-t, cdbSNP:149397714
complement(1014)-g, adbSNP:201758954
complement(1035)-g, adbSNP:138975479
complement(1037)-t, cdbSNP:200289289
complement(1066)-dbSNP:
complement(1066)-g, adbSNP:114494558
complement(1074)-t, cdbSNP:150372878
complement(1135)-t, cdbSNP:147568145
complement(1151)-t, cdbSNP:267601217
complement(1161)-t, cdbSNP:146922726
complement(1173)-c, adbSNP:200513558
complement(1195)-t, cdbSNP:113998363
complement(1235)-t, cdbSNP:114926265
complement(1252)-g, adbSNP:142192165
complement(1264)-g, adbSNP:112207413
complement(1268)-g, cdbSNP:143050366
complement(1350)-dbSNP:
complement(1350)-t, cdbSNP:367835154
complement(1357)-g, adbSNP:199686580
complement(1361)-c, adbSNP:199647053
complement(1366)-g, adbSNP:148661497
complement(1387)-t, cdbSNP:374189538
complement(1391)-t, gdbSNP:144978163
complement(1418)-g, adbSNP:201767049
complement(1480)-dbSNP:
complement(1480)-t, cdbSNP:376968265
complement(1496)-g, cdbSNP:56146903
complement(1504)-g, cdbSNP:144150588
complement(1515)-g, adbSNP:74854625
complement(1527)-t, adbSNP:139378075
complement(1537)-t, cdbSNP:73712207
complement(1541)-g, adbSNP:142746698
complement(1546)-g, adbSNP:139321058
complement(1554)-g, adbSNP:111409626
complement(1565)-t, cdbSNP:182533022
complement(1640)-dbSNP:
complement(1640)-t, cdbSNP:372015884
complement(1643)-t, cdbSNP:150850005
complement(1675)-t, cdbSNP:369617694
complement(1677)-t, adbSNP:375542264
complement(1681)-t, cdbSNP:115637425
complement(1692)-g, adbSNP:372928932
complement(1720)-dbSNP:
complement(1720)-t, cdbSNP:41276157
complement(1726)-g, cdbSNP:200373269
complement(1730)-g, adbSNP:115407456
complement(1756)-t, cdbSNP:41276154
complement(1760)-g, adbSNP:115160339
complement(1793)-g, adbSNP:371529135
complement(1815)-g, adbSNP:144116037
complement(1847)-g, cdbSNP:368090783
complement(1856)-t, adbSNP:200058688
complement(1863)-g, adbSNP:115116578
complement(1868)-g, cdbSNP:374546580
complement(1906)-t, c, adbSNP:138532222
complement(1930)-dbSNP:
complement(1930)-g, adbSNP:146938907
complement(1936)-t, cdbSNP:2072403
complement(1955)-g, adbSNP:369272208
complement(1956)-t, cdbSNP:201371180
complement(1959)-g, adbSNP:78008536
complement(1984)-g, adbSNP:79620906
complement(2048)-t, gdbSNP:115734214
2052+a, gdbSNP:398124190
complement(2073)-dbSNP:
complement(2073)-g, adbSNP:114993407
complement(2075)-t, gdbSNP:150988816
complement(2084)-t, cdbSNP:201735865
complement(2096)-g, adbSNP:115831287
complement(2097)-t, cdbSNP:377185504
complement(2108)-t, adbSNP:371652596
complement(2112)-t, cdbSNP:144078760
complement(2119)-t, adbSNP:114106438
complement(2135)-t, gdbSNP:199851352
complement(2166)-dbSNP:
complement(2166)-t, adbSNP:139445071
complement(2175)-g, adbSNP:201044262
complement(2176)-t, cdbSNP:146749232
complement(2211)-t, cdbSNP:112524355
complement(2281)-dbSNP:
complement(2281)-g, adbSNP:201944880
complement(2282)-g, adbSNP:114405029
complement(2285)-t, c, adbSNP:114577182
complement(2336)-t, adbSNP:200007424
complement(2349)-t, cdbSNP:370858334
complement(2412)-t, gdbSNP:116504075
complement(2414)-c, adbSNP:376412270
complement(2416)-g, adbSNP:115542380
complement(2441)-g, adbSNP:374189896
complement(2499)-dbSNP:
complement(2499)-g, cdbSNP:375755673
complement(2511)-g, adbSNP:144235468
complement(2512)-t, cdbSNP:148510862
2536+c, tdbSNP:398124191
complement(2578)-g, adbSNP:199631495
complement(2594)-g, cdbSNP:3025968
complement(2606)-g, adbSNP:144653976
complement(2636)-dbSNP:
complement(2636)-c, adbSNP:369844245
complement(2692)-t, g, cdbSNP:113842330
complement(2695)-c, adbSNP:3025966
complement(2712)-t, cdbSNP:113374697
complement(2726)-t, cdbSNP:371309082
complement(2740)-g, adbSNP:149804405
complement(2820)-g, adbSNP:116033707
complement(2833)-t, cdbSNP:201156261
complement(2848)-g, adbSNP:368049278
complement(2849)-t, cdbSNP:115167821
complement(2857)-g, adbSNP:368168602
complement(2884)-dbSNP:
complement(2884)-c, adbSNP:202070369
complement(2914)-t, cdbSNP:114620008
complement(2950)-g, cdbSNP:371610137
complement(2985)-g, adbSNP:200653362
complement(2987)-g, adbSNP:190615928
complement(3028)-g, adbSNP:362694
complement(3057)-dbSNP:
complement(3057)-t, adbSNP:3025963
complement(3092)-t, cdbSNP:3025962
complement(3098)-g, cdbSNP:373969392
complement(3104)-t, gdbSNP:143972828
complement(3114)-g, cdbSNP:138598422
complement(3149)-g, c, adbSNP:362691
complement(3152)-g, cdbSNP:201003473
complement(3188)-dbSNP:
complement(3188)-g, adbSNP:375752077
complement(3189)-t, cdbSNP:373089551
complement(3190)-g, adbSNP:375739415
complement(3211)-t, cdbSNP:368869061
complement(3220)-g, adbSNP:115886170
complement(3283)-g, adbSNP:41276148
complement(3285)-g, adbSNP:41276145
complement(3289)-g, adbSNP:149062691
complement(3350)-dbSNP:
complement(3350)-t, cdbSNP:114389730
complement(3357)-g, adbSNP:116225248
complement(3439)-t, gdbSNP:373092804
complement(3551)-dbSNP:
complement(3551)-g, adbSNP:189964840
complement(3571)-g, adbSNP:137974322
complement(3584)-t, adbSNP:145484343
complement(3617)-t, cdbSNP:116119591
complement(3636)-t, cdbSNP:146768228
complement(3637)-t, gdbSNP:114684479
complement(3649)-g, adbSNP:267601216
complement(3671)-t, cdbSNP:374443790
complement(3753)-dbSNP:
complement(3753)-t, c, adbSNP:114655373
complement(3767)-t, cdbSNP:140868852
complement(3802)-g, adbSNP:151252449
complement(3811)-g, cdbSNP:56342240
complement(3823)-g, adbSNP:199705497
complement(3827)-t, cdbSNP:200269227
complement(3857)-t, gdbSNP:201705793
complement(3867)-g, cdbSNP:370741155
complement(3872)-dbSNP:
complement(3872)-t, gdbSNP:114003896
complement(3905)-t, adbSNP:148751867
complement(3964)-g, adbSNP:373549838
complement(3975)-g, adbSNP:375784624
complement(3983)-c, adbSNP:112494578
complement(3999)-t, cdbSNP:55689103
complement(4051)-t, adbSNP:145600583
complement(4060)-t, cdbSNP:372465717
complement(4078)-dbSNP:
complement(4078)-g, adbSNP:369450191
complement(4112)-g, cdbSNP:140090640
complement(4118)-g, adbSNP:376446603
complement(4180)-t, cdbSNP:200206522
complement(4231)-g, adbSNP:116688780
complement(4247)-t, cdbSNP:114195202
complement(4265)-t, adbSNP:115633553
complement(4299)-g, adbSNP:372401833
complement(4300)-t, gdbSNP:368469945
complement(4342)-dbSNP:
complement(4342)-t, cdbSNP:147496823
complement(4387)-g, adbSNP:149436053
complement(4388)-t, cdbSNP:374927338
complement(4390)-t, cdbSNP:184601053
complement(4417)-g, adbSNP:138924805
complement(4420)-t, cdbSNP:150518726
complement(4425)-t, cdbSNP:192235848
complement(4435)-t, cdbSNP:141617635
complement(4474)-dbSNP:
complement(4474)-t, adbSNP:368010584
complement(4497)-t, cdbSNP:115577014
complement(4512)-g, adbSNP:137965786
complement(4513)-g, adbSNP:370743731
complement(4514)-t, cdbSNP:114446781
complement(4557)-g, adbSNP:188328812
complement(4568)-t, cdbSNP:143213152
complement(4588)-t, gdbSNP:376838638
complement(4594)-g, cdbSNP:375118721
complement(4597)-t, g, adbSNP:200920818
complement(4598)-t, cdbSNP:201371893
complement(4617)-t, cdbSNP:202161592
complement(4627)-t, cdbSNP:267601215
complement(4640)-g, adbSNP:140263617
complement(4642)-t, cdbSNP:377181911
complement(4644)-g, adbSNP:369404310
complement(4655)-g, cdbSNP:200428576
complement(4657)-g, adbSNP:374062563
complement(4694)-dbSNP:
complement(4694)-t, cdbSNP:371643338
complement(4732)-t, cdbSNP:372849299
complement(4790)-dbSNP:
complement(4790)-g, adbSNP:373010833
complement(4849)-g, adbSNP:138694965
complement(4879)-t, cdbSNP:370566453
complement(4880)-t, cdbSNP:78480723
complement(4900)-t, cdbSNP:377118940
complement(4908)-dbSNP:
complement(4908)-t, cdbSNP:370055024
complement(4974)-t, cdbSNP:267601214
complement(4998)-g, adbSNP:201945386
complement(5003)-g, cdbSNP:375040526
complement(5008)-c, adbSNP:200733882
complement(5025)-t, cdbSNP:114306581
complement(5028)-g, adbSNP:368468964
complement(5032)-t, cdbSNP:149121159
complement(5053)-g, cdbSNP:201296719
complement(5105)-dbSNP:
complement(5105)-g, adbSNP:368740749
complement(5110)-g, adbSNP:145072594
complement(5114)-g, cdbSNP:200566073
complement(5146)-g, cdbSNP:78221963
complement(5166)-g, cdbSNP:373730762
complement(5179)-t, gdbSNP:370258062
complement(5202)-t, cdbSNP:140931550
complement(5224)-t, cdbSNP:376512990
complement(5245)-g, adbSNP:199766147
complement(5248)-g, adbSNP:114551393
complement(5255)-t, cdbSNP:147657490
5268+c, gdbSNP:2229860
complement(5275)-g, cdbSNP:139945641
complement(5296)-t, cdbSNP:147933593
complement(5305)-t, cdbSNP:113229231
complement(5316)-g, adbSNP:115913736
complement(5317)-t, cdbSNP:144388452
complement(5360)-g, cdbSNP:362800
complement(5370)-g, adbSNP:202116849
complement(5385)-dbSNP:
complement(5385)-t, cdbSNP:199553777
complement(5408)-t, adbSNP:200364591
complement(5434)-c, adbSNP:139102992
complement(5444)-t, cdbSNP:79499902
complement(5480)-t, cdbSNP:141655702
complement(5483)-g, adbSNP:368992119
complement(5504)-g, adbSNP:138576725
complement(5510)-t, cdbSNP:374736779
complement(5519)-dbSNP:
complement(5519)-g, adbSNP:115549751
complement(5520)-g, cdbSNP:372887562
complement(5558)-g, cdbSNP:150148125
complement(5615)-g, cdbSNP:201017713
complement(5625)-g, cdbSNP:141734678
complement(5634)-t, cdbSNP:368478306
complement(5640)-t, cdbSNP:374941914
complement(5688)-c, adbSNP:114313194
complement(5727)-dbSNP:
complement(5727)-g, cdbSNP:202128727
complement(5731)-t, cdbSNP:374234799
complement(5773)-t, cdbSNP:368944281
complement(5778)-dbSNP:
complement(5778)-g, adbSNP:41275239
complement(5803)-t, cdbSNP:141387255
complement(5812)-t, gdbSNP:147672691
complement(5828)-t, cdbSNP:147026512
complement(5871)-g, adbSNP:114190729
complement(5874)-t, cdbSNP:141679923
complement(5921)-t, cdbSNP:373070497
5935+a, gdbSNP:2711866
complement(5951)-t, cdbSNP:369993428
complement(5956)-g, adbSNP:200299096
complement(5982)-dbSNP:
complement(5982)-g, adbSNP:149837553
complement(5991)-c, adbSNP:77664442
complement(5996)-t, gdbSNP:375324082
complement(6016)-g, adbSNP:375228702
complement(6040)-t, cdbSNP:362793
complement(6053)-t, gdbSNP:370624724
complement(6064)-t, gdbSNP:142987135
6068+a, cdbSNP:3025939
complement(6080)-g, cdbSNP:139740983
complement(6083)-t, cdbSNP:114807343
complement(6094)-g, adbSNP:141509094
complement(6095)-t, cdbSNP:139892362
complement(6098)-g, adbSNP:372192742
complement(6121)-c, adbSNP:143948239
complement(6129)-g, adbSNP:149473868
complement(6191)-dbSNP:
complement(6191)-g, adbSNP:374628146
complement(6196)-g, cdbSNP:114461466
complement(6238)-dbSNP:
complement(6238)-g, adbSNP:79610081
complement(6244)-g, adbSNP:114019779
complement(6262)-t, adbSNP:368034037
complement(6264)-g, adbSNP:369240714
complement(6265)-g, adbSNP:375117582
complement(6266)-t, cdbSNP:371614773
complement(6267)-g, adbSNP:368438329
complement(6268)-c, adbSNP:116371919
complement(6301)-t, cdbSNP:386424294
complement(6301)-g, adbSNP:79161241
complement(6306)-g, adbSNP:374232523
complement(6307)-t, cdbSNP:116750302
complement(6314)-g, adbSNP:114306593
complement(6326)-g, adbSNP:200409290
complement(6330)-c, adbSNP:138909076
complement(6353)-t, cdbSNP:201627577
complement(6360)-g, adbSNP:368566543
complement(6374)-t, cdbSNP:147042966
complement(6386)-t, cdbSNP:141539733
complement(6388)-g, adbSNP:115379833
complement(6400)-g, adbSNP:201505136
complement(6433)-g, adbSNP:143293865
complement(6438)-t, gdbSNP:149152189
complement(6503)-dbSNP:
complement(6503)-t, cdbSNP:116716038
complement(6618)-t, cdbSNP:144387303
complement(6631)-t, cdbSNP:370086835
complement(6636)-t, cdbSNP:375440000
complement(6648)-g, adbSNP:200947359
complement(6679)-g, adbSNP:146913017
complement(6680)-t, cdbSNP:146877597
complement(6713)-dbSNP:
complement(6713)-t, adbSNP:114686696
complement(6792)-t, cdbSNP:374088118
complement(6807)-t, cdbSNP:200010849
complement(6833)-dbSNP:
complement(6833)-g, adbSNP:375819905
complement(6858)-t, cdbSNP:139819388
complement(6862)-g, adbSNP:2075043
complement(6886)-g, cdbSNP:201422815
complement(6896)-t, cdbSNP:201561165
complement(6924)-t, cdbSNP:142573628
complement(6931)-t, cdbSNP:367867782
complement(6979)-t, gdbSNP:148419722
complement(6990)-g, adbSNP:374796794
complement(7013)-g, adbSNP:144565023
complement(7014)-t, c, adbSNP:116394157
complement(7048)-t, cdbSNP:142792443
complement(7085)-t, cdbSNP:138978280
complement(7098)-dbSNP:
complement(7098)-g, adbSNP:141004002
complement(7099)-g, adbSNP:113498433
complement(7122)-g, adbSNP:116065504
complement(7146)-g, adbSNP:201403495
complement(7151)-t, cdbSNP:370037754
complement(7196)-t, cdbSNP:201788015
complement(7214)-c, adbSNP:375751630
complement(7215)-t, adbSNP:143688278
complement(7246)-g, adbSNP:362747
complement(7267)-g, adbSNP:114339919
complement(7270)-g, adbSNP:362746
complement(7271)-t, cdbSNP:79377093
complement(7274)-t, cdbSNP:114344654
complement(7288)-g, cdbSNP:116057819
complement(7334)-t, adbSNP:369274683
complement(7357)-dbSNP:
complement(7357)-g, adbSNP:368769147
complement(7391)-t, cdbSNP:375160285
complement(7413)-t, cdbSNP:145844782
complement(7428)-t, cdbSNP:140660860
complement(7450)-t, cdbSNP:146835733
complement(7499)-g, cdbSNP:371476408
complement(7524)-dbSNP:
complement(7524)-t, cdbSNP:201860717
complement(7530)-c, adbSNP:371157614
complement(7558)-t, cdbSNP:376360223
complement(7562)-g, cdbSNP:372556955
complement(7574)-t, cdbSNP:370008362
complement(7598)-t, cdbSNP:150236371
complement(7649)-t, cdbSNP:375694777
complement(7690)-dbSNP:
complement(7690)-g, adbSNP:2075038
complement(7691)-t, cdbSNP:367906773
complement(7698)-g, cdbSNP:114647348
complement(7714)-g, adbSNP:115728370
complement(7740)-t, gdbSNP:114620403
complement(7741..7742)-, gdbSNP:34824760
complement(7775)-g, adbSNP:372903287
complement(7794)-g, adbSNP:116634494
complement(7795)-g, adbSNP:114894883
complement(7803)-g, adbSNP:139106600
complement(7804)-t, cdbSNP:150743664
complement(7853)-dbSNP:
complement(7853)-t, cdbSNP:184128506
complement(7917)-g, adbSNP:202172902
complement(7932)-t, cdbSNP:113358456
complement(7988)-t, cdbSNP:200076453
complement(8020)-g, adbSNP:116838125
complement(8021)-t, cdbSNP:144453936
complement(8045)-dbSNP:
complement(8045)-g, cdbSNP:140515422
complement(8047)-g, adbSNP:56345626
complement(8063)-c, adbSNP:143751470
complement(8076)-t, cdbSNP:369735904
complement(8089)-t, cdbSNP:377059168
complement(8113)-g, adbSNP:148056599
complement(8120)-t, cdbSNP:200915887
complement(8132)-t, cdbSNP:368934789
complement(8137)-g, adbSNP:375004506
complement(8149)-c, adbSNP:181844615
complement(8160)-t, cdbSNP:371690632
complement(8163)-g, adbSNP:144249461
complement(8164)-g, adbSNP:368087558
complement(8165)-t, cdbSNP:375985673
complement(8196)-t, adbSNP:371701444
8206+c, tdbSNP:2229864
complement(8211)-t, cdbSNP:201157987
complement(8216)-g, adbSNP:113077111
complement(8228)-t, cdbSNP:201264902
complement(8237)-t, cdbSNP:377549748
complement(8245)-g, adbSNP:138241126
complement(8246)-t, cdbSNP:115640958
8296+dbSNP:
8296+a, gdbSNP:3808039
complement(8334)-g, adbSNP:138975709
complement(8365)-g, adbSNP:145089397
complement(8372)-g, adbSNP:202166176
complement(8373)-c, adbSNP:141115137
complement(8375)-g, cdbSNP:151110176
complement(8417)-g, adbSNP:113664938
complement(8428)-t, cdbSNP:143469522
complement(8455)-dbSNP:
complement(8455)-t, cdbSNP:148821179
complement(8571)-g, adbSNP:192835206
complement(8585)-t, cdbSNP:377669512
complement(8652)-dbSNP:
complement(8652)-g, adbSNP:147760518
complement(8653)-t, cdbSNP:374053764
complement(8666)-c, adbSNP:144309551
8668+c, g, tdbSNP:2229862
complement(8702)-t, cdbSNP:147624295
complement(8764)-t, cdbSNP:201982015
complement(8766)-t, adbSNP:373868525
complement(8785)-t, cdbSNP:190273964
complement(8786)-t, cdbSNP:371264058
complement(8794)-t, cdbSNP:377429197
complement(8798)-g, adbSNP:113775740
complement(8800)-t, cdbSNP:369307806
complement(8833)-dbSNP:
complement(8833)-g, adbSNP:200157006
complement(8845)-g, adbSNP:201097384
complement(8857)-t, cdbSNP:149925383
complement(8863)-t, gdbSNP:367803009
complement(8926)-g, adbSNP:115560688
complement(8955)-t, gdbSNP:139225791
complement(8958)-g, adbSNP:201656873
complement(8971)-t, cdbSNP:144728023
complement(8999)-c, adbSNP:141307064
complement(9016)-dbSNP:
complement(9016)-g, adbSNP:374064080
complement(9023)-g, adbSNP:114501042
complement(9048)-g, adbSNP:200781285
complement(9083)-t, cdbSNP:369856463
complement(9103)-g, adbSNP:199505446
complement(9104)-t, cdbSNP:148509350
complement(9106)-g, adbSNP:146294622
complement(9133)-dbSNP:
complement(9133)-g, adbSNP:375502019
complement(9160)-g, adbSNP:373401306
complement(9192)-t, cdbSNP:117061495
complement(9269)-g, cdbSNP:142059680
complement(9270)-t, adbSNP:200611412
complement(9321)-t, gdbSNP:192043003
9332+c, tdbSNP:2286261
complement(9439)-dbSNP:
complement(9439)-g, adbSNP:138856852
complement(9481)-g, adbSNP:150387973
complement(9489)-t, cdbSNP:368572382
9499+c, tdbSNP:398124193
complement(9500)-t, cdbSNP:149613347
complement(9510)-g, cdbSNP:376611357
complement(9516)-g, adbSNP:138348347
complement(9574)-dbSNP:
complement(9574)-g, adbSNP:375427974
complement(9579)-c, adbSNP:368644580
complement(9599)-t, cdbSNP:150485168
complement(9626)-dbSNP:
complement(9626)-g, cdbSNP:189008268
complement(9638)-g, cdbSNP:185075003
complement(9684)-t, gdbSNP:74513461
complement(9742)-g, cdbSNP:7456504
complement(9749)-t, cdbSNP:147777191
complement(9754)-g, adbSNP:145730672
complement(9793)-dbSNP:
complement(9793)-t, cdbSNP:114211457
complement(9803)-t, cdbSNP:142094612
complement(9805)-g, adbSNP:116437202
complement(9824)-t, cdbSNP:142638365
complement(9838)-g, adbSNP:372732044
complement(9868)-g, adbSNP:200370282
complement(9874)-g, adbSNP:78218774
complement(9886)-t, cdbSNP:370000503
complement(9889)-g, adbSNP:145542111
complement(9890)-t, cdbSNP:73714410
complement(9911)-t, cdbSNP:376520049
complement(9985)-dbSNP:
complement(9985)-g, adbSNP:149713137
complement(9997)-g, c, adbSNP:202224350
complement(10041)-t, cdbSNP:367980074
complement(10045)-t, gdbSNP:201905927
complement(10061)-t, adbSNP:201189495
complement(10063)-g, adbSNP:73714404
10106+g, tdbSNP:75231064
complement(10108)-t, cdbSNP:141930548
complement(10150)-dbSNP:
complement(10150)-t, gdbSNP:140101375
complement(10176)-g, adbSNP:150638029
complement(10185)-g, adbSNP:201703640
complement(10219)-g, adbSNP:201349789
complement(10228)-g, adbSNP:35827501
10234+a, gdbSNP:1062831
complement(10234)-t, cdbSNP:386479685
complement(10238)-t, gdbSNP:372441410
complement(10246)-, tdbSNP:35366668
complement(10253)-t, cdbSNP:115035120
complement(10257)-t, cdbSNP:148140675
complement(10426)-dbSNP:
complement(10426)-g, adbSNP:200761409
complement(10436)-t, cdbSNP:188371196
complement(10470)-dbSNP:
complement(10470)-g, adbSNP:377638585
complement(10482)-t, cdbSNP:116463039
complement(10500)-t, cdbSNP:201731543
complement(10515)-t, cdbSNP:149434986
complement(10517)-g, adbSNP:139326865
complement(10518)-t, cdbSNP:200731411
complement(10580)-t, cdbSNP:374606622
complement(10610)-t, cdbSNP:112874175
complement(10694)-g, adbSNP:7811571
complement(10825)-g, adbSNP:113183151
complement(10940)-t, cdbSNP:7811262
11106+g, tdbSNP:150458916
complement(11119)-t, cdbSNP:141550459
complement(11185)-t, cdbSNP:112080021
complement(11203)-t, gdbSNP:187884312
complement(11305)-c, adbSNP:183193019
complement(11418)-g, adbSNP:369135489
Gene SymbolRELN
Gene SynonymLIS2; PRO1598; RL
Chromosome7
Locus Map7q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005045 Homo sapiens reelin (RELN), transcript variant 1, mRNA. On-demand TBD TBD
NM_005045 Homo sapiens reelin (RELN), transcript variant 1, mRNA. On-demand TBD TBD
Title Erythroid differentiation is augmented in Reelin-deficient K562 cells and homozygous reeler mice .
Author Chu HC, Lee HY, Huang YS, Tseng WL, Yen CJ, Cheng JC and Tseng CP.
Journal FEBS Lett. 588 (1), 58-64 (2014)
Title An introduction of genetics in otosclerosis: a systematic review .
Author Bittermann AJ, Wegner I, Noordman BJ, Vincent R, van der Heijden GJ and Grolman W.
Journal Otolaryngol Head Neck Surg 150 (1), 34-39 (2014)
Title Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study .
Author Yu B, Zheng Y, Alexander D, Manolio TA, Alonso A, Nettleton JA and Boerwinkle E.
Journal Genet. Epidemiol. 37 (8), 840-845 (2013)
Title Decisive role of Reelin signaling during early stages of Alzheimer's disease .
Author Krstic D, Pfister S, Notter T and Knuesel I.
Journal Neuroscience 246, 108-116 (2013)
Title Beta-amyloid impairs reelin signaling .
Author Cuchillo-Ibanez I, Balmaceda V, Botella-Lopez A, Rabano A, Avila J and Saez-Valero J.
Journal PLoS ONE 8 (8), E72297 (2013)
Title Reelin is a ligand for lipoprotein receptors .
Author D'Arcangelo G, Homayouni R, Keshvara L, Rice DS, Sheldon M and Curran T.
Journal Neuron 24 (2), 471-479 (1999)
Title Evolutionarily conserved, alternative splicing of reelin during brain development .
Author Lambert de Rouvroit C, Bernier B, Royaux I, de Bergeyck V and Goffinet AM.
Journal Exp. Neurol. 156 (2), 229-238 (1999)
Title A decrease of reelin expression as a putative vulnerability factor in schizophrenia .
Author Impagnatiello F, Guidotti AR, Pesold C, Dwivedi Y, Caruncho H, Pisu MG, Uzunov DP, Smalheiser NR, Davis JM, Pandey GN, Pappas GD, Tueting P, Sharma RP and Costa E.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (26), 15718-15723 (1998)
Title The human reelin gene: isolation, sequencing, and mapping on chromosome 7 .
Author DeSilva,U., D'Arcangelo,G., Braden,V.V., Chen,J., Miao,G.G., Curran,T. and Green,E.D.
Journal Genome Res. 7 (2), 157-164 (1997)
Title A protein related to extracellular matrix proteins deleted in the mouse mutant reeler .
Author D'Arcangelo G, Miao GG, Chen SC, Soares HD, Morgan JI and Curran T.
Journal Nature 374 (6524), 719-723 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.