• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005077 Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_005077.3, 34147712
Length 3283 bp
Structure linear
Update Date 06-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA.
Product transducin-like enhancer protein 1
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC010100.2. On Aug 25, 2003 this sequence version replaced gi:21541823.

RefSeq NP_005068.2
CDS 442..2754
Misc Feature(1)358..360
Misc Feature(2)442..846
Misc Feature(3)442..846
Misc Feature(4)1039..1245
Misc Feature(5)1114..1125
Misc Feature(6)1156..1158
Misc Feature(7)1297..1299
Misc Feature(8)1849..1944
Misc Feature(9)<1867..2745
Misc Feature(10)1888..2742
Misc Feature(11)order(1888..1890,1942..1944,1969..1974,2020..2025,
Misc Feature(12)2023..2115
Misc Feature(13)2155..2247
Misc Feature(14)2281..2373
Misc Feature(15)2527..2619
Misc Feature(16)2650..2742
Exon (1)1..465
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (2)466..566
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (3)567..630
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (4)631..675
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (5)676..738
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (6)739..813
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (7)814..1018
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (8)1019..1035
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (9)1036..1152
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (10)1153..1206
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (11)1207..1359
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (12)1360..1504
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (13)1505..1695
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (14)1696..1772
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (15)1773..2022
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (16)2023..2270
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (17)2271..2418
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (18)2419..2569
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (19)2570..2646
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (20)2647..3269
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Translation MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(24)-dbSNP:
complement(24)-g, adbSNP:373880981
complement(25)-t, gdbSNP:62576223
complement(29)-g, cdbSNP:184746527
complement(133)-g, cdbSNP:370904391
complement(155)-t, cdbSNP:2244732
complement(172)-t, gdbSNP:114044562
complement(330)-g, adbSNP:115757298
complement(334)-g, adbSNP:192561519
complement(347)-g, cdbSNP:117167900
complement(354)-c, adbSNP:143943648
complement(358)-g, adbSNP:149895059
complement(369)-c, adbSNP:369345680
complement(371)-g, adbSNP:376593345
complement(408)-t, cdbSNP:55697345
complement(414)-t, cdbSNP:374897058
complement(422)-g, adbSNP:370440694
complement(450)-t, cdbSNP:372990411
complement(479)-dbSNP:
complement(479)-g, adbSNP:372989218
complement(492)-g, adbSNP:141524882
complement(504)-g, adbSNP:147523347
540+c, tdbSNP:1385042
complement(545)-t, adbSNP:375169580
complement(546)-g, adbSNP:372529003
complement(600)-dbSNP:
complement(600)-t, cdbSNP:145280231
complement(631)-dbSNP:
complement(631)-g, adbSNP:139678120
complement(657)-g, adbSNP:375571812
complement(660)-t, adbSNP:142563667
complement(699)-dbSNP:
complement(699)-g, adbSNP:145545216
complement(701)-g, adbSNP:149694150
complement(759)-dbSNP:
complement(759)-g, cdbSNP:368162519
complement(765)-g, adbSNP:114633202
795+a, gdbSNP:2228173
complement(800)-t, cdbSNP:141647936
complement(803)-g, adbSNP:375709041
complement(807)-t, gdbSNP:183768719
complement(816)-dbSNP:
complement(816)-t, cdbSNP:139072711
complement(840)-c, adbSNP:138795312
complement(852)-g, adbSNP:41296045
complement(853)-t, cdbSNP:373984023
complement(865)-g, adbSNP:142213189
complement(879)-g, adbSNP:370867475
complement(909)-t, cdbSNP:61738504
complement(910)-g, adbSNP:376167085
complement(928)-t, cdbSNP:143365960
complement(934)-g, adbSNP:201385680
complement(939)-t, cdbSNP:373534225
complement(945)-g, adbSNP:17851325
complement(954)-c, adbSNP:373647454
complement(998)-t, cdbSNP:375954684
complement(999)-g, adbSNP:149612113
complement(1009)-g, adbSNP:138237725
complement(1015)-t, cdbSNP:199776589
complement(1021)-dbSNP:
complement(1021)-t, cdbSNP:150422613
complement(1049)-dbSNP:
complement(1049)-g, adbSNP:371930193
complement(1053)-g, adbSNP:61734164
complement(1054)-g, cdbSNP:201045494
complement(1071)-g, adbSNP:201496962
complement(1081)-g, adbSNP:374215758
complement(1104)-g, adbSNP:147867092
complement(1106)-t, cdbSNP:372554811
complement(1141)-g, adbSNP:201636079
complement(1173)-dbSNP:
complement(1173)-g, adbSNP:147012155
1192+g, tdbSNP:1804530
complement(1195)-t, cdbSNP:141391384
complement(1214)-dbSNP:
complement(1214)-g, adbSNP:151221865
complement(1221)-t, cdbSNP:142189746
complement(1225)-t, cdbSNP:188339598
complement(1234)-c, adbSNP:373106021
complement(1260)-g, adbSNP:369913450
complement(1272)-g, adbSNP:147541111
complement(1284)-t, cdbSNP:61733322
complement(1296)-g, adbSNP:376952071
complement(1320)-t, cdbSNP:373782434
complement(1424)-dbSNP:
complement(1424)-g, adbSNP:144027618
complement(1442)-g, cdbSNP:374569361
complement(1465)-t, cdbSNP:376454144
complement(1492)-t, g, cdbSNP:61733323
complement(1503)-t, cdbSNP:200879309
complement(1536)-dbSNP:
complement(1536)-g, adbSNP:139111374
complement(1542)-t, cdbSNP:146168410
complement(1572)-g, adbSNP:371977486
complement(1579)-t, cdbSNP:141525822
complement(1605)-g, adbSNP:140201906
complement(1614)-g, adbSNP:150688751
complement(1615)-t, cdbSNP:141959893
complement(1626)-t, gdbSNP:148132074
complement(1635)-t, cdbSNP:372238712
complement(1638)-g, adbSNP:143717216
complement(1650)-g, adbSNP:377648854
complement(1662)-t, cdbSNP:368970037
complement(1665)-g, adbSNP:373511583
complement(1679)-t, cdbSNP:369565989
complement(1685)-t, cdbSNP:376844498
complement(1715)-dbSNP:
complement(1715)-t, gdbSNP:143065311
complement(1729)-g, cdbSNP:139039794
complement(1750)-c, adbSNP:146461149
complement(1755)-t, gdbSNP:142337941
complement(1767)-c, adbSNP:201391449
complement(1772)-g, adbSNP:201086026
1796+dbSNP:
1796+c, tdbSNP:1804529
complement(1800)-g, adbSNP:202222787
complement(1830)-g, adbSNP:373201668
complement(1905)-g, adbSNP:111435537
complement(1923)-g, adbSNP:61733324
complement(1935)-g, adbSNP:150161989
complement(1947)-g, adbSNP:151236625
complement(1959)-g, adbSNP:140842722
2010+g, tdbSNP:1804531
complement(2059)-dbSNP:
complement(2059)-g, cdbSNP:200982473
complement(2060)-g, adbSNP:199536347
complement(2062)-t, cdbSNP:201140985
complement(2063)-t, cdbSNP:201576970
complement(2067)-g, adbSNP:201562294
complement(2118)-t, cdbSNP:150975417
complement(2121)-t, cdbSNP:144048030
complement(2125)-g, adbSNP:373236831
complement(2130)-t, cdbSNP:8782
complement(2133)-t, cdbSNP:369331200
complement(2135)-t, cdbSNP:146691736
complement(2153)-g, adbSNP:201873489
complement(2154)-t, cdbSNP:143199419
complement(2159)-g, adbSNP:148605258
complement(2166)-g, adbSNP:372013873
complement(2185)-t, cdbSNP:368595624
complement(2193)-g, adbSNP:375550899
complement(2239)-c, adbSNP:201024387
complement(2277)-dbSNP:
complement(2277)-g, adbSNP:375599212
complement(2310)-g, adbSNP:371089248
complement(2366)-g, adbSNP:144402543
complement(2377)-g, adbSNP:150052634
complement(2379)-g, adbSNP:139363416
complement(2404)-t, cdbSNP:200896348
complement(2410)-t, adbSNP:61733325
2427+dbSNP:
2427+c, tdbSNP:2229269
2445+c, tdbSNP:2229270
complement(2451)-t, cdbSNP:111867781
complement(2458)-t, cdbSNP:202236753
2460+a, gdbSNP:2228172
complement(2475)-g, adbSNP:143208469
complement(2502)-g, adbSNP:201265824
complement(2523..2524)-, cdbSNP:34606017
complement(2529)-t, cdbSNP:111524366
complement(2541)-g, adbSNP:375370302
complement(2550)-g, adbSNP:147941591
complement(2627)-dbSNP:
complement(2627)-t, cdbSNP:146295477
complement(2629)-t, cdbSNP:144142208
complement(2661)-dbSNP:
complement(2661)-t, cdbSNP:113310260
complement(2667)-g, cdbSNP:374286795
complement(2682)-t, gdbSNP:139183942
complement(2773)-g, adbSNP:370336465
complement(2782)-g, adbSNP:374897124
complement(2803)-g, adbSNP:377175662
complement(2807)-g, adbSNP:377409221
complement(2842)-, tdbSNP:142458504
complement(2862)-c, adbSNP:138753856
2949+a, cdbSNP:10420
complement(2949)-c, adbSNP:386512863
complement(2972)-t, cdbSNP:185957296
complement(2994)-t, gdbSNP:116016721
complement(3032)-g, cdbSNP:144840812
complement(3074)-c, adbSNP:815855
complement(3145..3146)-, gdbSNP:35737418
complement(3248)-t, cdbSNP:372729938
complement(3264)-t, gdbSNP:79157085
Gene SymbolTLE1
Gene SynonymESG; ESG1; GRG1
Chromosome9
Locus Map9q21.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005077 Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA. In-stock $809.00 $760.00 15
XM_005252151 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X1, mRNA. On-demand $899.00 20
XM_005252152 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X2, mRNA. On-demand $899.00 20
XM_006717258 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X14, mRNA. On-demand $899.00 20
XM_005252153 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X3, mRNA. On-demand $899.00 20
XM_005252154 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X4, mRNA. On-demand $899.00 20
XM_005252155 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X5, mRNA. On-demand $899.00 20
XM_005252156 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X6, mRNA. On-demand $899.00 20
XM_006717259 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X15, mRNA. On-demand $849.00 20
XM_006717260 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X16, mRNA. On-demand $849.00 20
XM_005252162 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X12, mRNA. On-demand $849.00 20
XM_005252163 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X13, mRNA. On-demand $849.00 20
XM_006717261 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X17, mRNA. On-demand $849.00 20
XM_006717262 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X18, mRNA. On-demand $899.00 20
XM_006717263 PREDICTED: Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), transcript variant X19, mRNA. On-demand $899.00 20
Title Specificity of TLE1 expression in unclassified high-grade sarcomas for the diagnosis of synovial sarcoma .
Author Valente AL, Tull J and Zhang S.
Journal Appl. Immunohistochem. Mol. Morphol. 21 (5), 408-413 (2013)
Title Increased cAMP in monocytes augments Notch signaling mechanisms by elevating RBP-J and transducin-like enhancer of Split (TLE) .
Author Larabee JL, Shakir SM, Barua S and Ballard JD.
Journal J. Biol. Chem. 288 (30), 21526-21536 (2013)
Title Immunohistochemical validation of TLE1, a novel marker, for synovial sarcomas .
Author Rekhi B, Basak R, Desai SB and Jambhekar NA.
Journal Indian J. Med. Res. 136 (5), 766-775 (2012)
Title TLE1 is an anoikis regulator and is downregulated by Bit1 in breast cancer cells .
Author Brunquell C, Biliran H, Jennings S, Ireland SK, Chen R and Ruoslahti E.
Journal Mol. Cancer Res. 10 (11), 1482-1495 (2012)
Title Multiple loci influencing hippocampal degeneration identified by genome scan .
Author Melville SA, Buros J, Parrado AR, Vardarajan B, Logue MW, Shen L, Risacher SL, Kim S, Jun G, DeCarli C, Lunetta KL, Baldwin CT, Saykin AJ and Farrer LA.
Journal Ann. Neurol. 72 (1), 65-75 (2012)
Title Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions .
Author Husain J, Lo R, Grbavec D and Stifani S.
Journal Biochem. J. 317 (PT 2), 523-531 (1996)
Title Molecular interaction between TLE1 and the carboxyl-terminal domain of HES-1 containing the WRPW motif .
Author Grbavec D and Stifani S.
Journal Biochem. Biophys. Res. Commun. 223 (3), 701-705 (1996)
Title Epithelial expression and chromosomal location of human TLE genes: implications for notch signaling and neoplasia .
Author Liu Y, Dehni G, Purcell KJ, Sokolow J, Carcangiu ML, Artavanis-Tsakonas S and Stifani S.
Journal Genomics 31 (1), 58-64 (1996)
Title Molecular cloning and expression of mouse and human cDNA encoding .
Author Miyasaka H, Choudhury BK, Hou EW and Li SS.
Journal Eur. J. Biochem. 216 (1), 343-352 (1993)
Title Human homologs of a Drosophila Enhancer of split gene product define a novel family of nuclear proteins .
Author Stifani S, Blaumueller CM, Redhead NJ, Hill RE and Artavanis-Tsakonas S.
Journal Nat. Genet. 2 (2), 119-127 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.