• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005077 Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_005077.3, 34147712
Length 3283 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA.
Product transducin-like enhancer protein 1
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC010100.2. On Aug 25, 2003 this sequence version replaced gi:21541823.

RefSeq NP_005068.2
CDS 442..2754
Misc Feature(1)358..360
Misc Feature(2)442..846
Misc Feature(3)442..846
Misc Feature(4)1039..1245
Misc Feature(5)1114..1125
Misc Feature(6)1156..1158
Misc Feature(7)1297..1299
Misc Feature(8)1849..1944
Misc Feature(9)1867..>2727
Misc Feature(10)1888..2619
Misc Feature(11)order(1888..1890,1942..1944,1969..1974,1987..1992,
Misc Feature(12)2023..2115
Misc Feature(13)2155..2247
Misc Feature(14)2281..2373
Misc Feature(15)2527..2619
Misc Feature(16)2650..2742
Exon (1)1..465
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (2)466..566
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (3)567..630
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (4)631..675
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (5)676..738
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (6)739..813
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (7)814..1018
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (8)1019..1035
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (9)1036..1152
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (10)1153..1206
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (11)1207..1359
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (12)1360..1504
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (13)1505..1695
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (14)1696..1772
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (15)1773..2022
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (16)2023..2270
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (17)2271..2418
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (18)2419..2569
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (19)2570..2646
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Exon (20)2647..3269
Gene:TLE1
Gene Synonym:ESG; ESG1; GRG1
Translation MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25)-dbSNP:
complement(25)-t, gdbSNP:62576223
complement(29)-g, cdbSNP:184746527
complement(155)-t, cdbSNP:2244732
complement(172)-t, gdbSNP:114044562
complement(330)-g, adbSNP:115757298
complement(334)-g, adbSNP:192561519
complement(347)-g, cdbSNP:117167900
complement(354)-c, adbSNP:143943648
complement(358)-g, adbSNP:149895059
complement(408)-t, cdbSNP:55697345
complement(492)-dbSNP:
complement(492)-g, adbSNP:141524882
complement(504)-g, adbSNP:147523347
complement(540)-t, cdbSNP:1385042
complement(600)-dbSNP:
complement(600)-t, cdbSNP:145280231
complement(631)-dbSNP:
complement(631)-g, adbSNP:139678120
complement(660)-t, adbSNP:142563667
complement(699)-dbSNP:
complement(699)-g, adbSNP:145545216
complement(701)-g, adbSNP:149694150
complement(765)-dbSNP:
complement(765)-g, adbSNP:114633202
complement(795)-g, adbSNP:2228173
complement(800)-t, cdbSNP:141647936
complement(807)-t, gdbSNP:183768719
complement(816)-dbSNP:
complement(816)-t, cdbSNP:139072711
complement(840)-c, adbSNP:138795312
complement(852)-g, adbSNP:41296045
complement(865)-g, adbSNP:142213189
complement(909)-t, cdbSNP:61738504
complement(928)-t, cdbSNP:143365960
complement(934)-g, adbSNP:201385680
complement(945)-g, adbSNP:17851325
complement(999)-g, adbSNP:149612113
complement(1009)-g, adbSNP:138237725
complement(1015)-t, cdbSNP:199776589
complement(1021)-dbSNP:
complement(1021)-t, cdbSNP:150422613
complement(1053)-dbSNP:
complement(1053)-g, adbSNP:61734164
complement(1054)-g, cdbSNP:201045494
complement(1071)-g, adbSNP:201496962
complement(1104)-g, adbSNP:147867092
complement(1141)-g, adbSNP:201636079
complement(1173)-dbSNP:
complement(1173)-g, adbSNP:147012155
complement(1192)-t, gdbSNP:1804530
complement(1195)-t, cdbSNP:141391384
complement(1214)-dbSNP:
complement(1214)-g, adbSNP:151221865
complement(1221)-t, cdbSNP:142189746
complement(1225)-t, cdbSNP:188339598
complement(1272)-g, adbSNP:147541111
complement(1284)-t, cdbSNP:61733322
complement(1424)-dbSNP:
complement(1424)-g, adbSNP:144027618
complement(1492)-g, cdbSNP:61733323
complement(1503)-t, cdbSNP:200879309
complement(1505..1506)-dbSNP:
complement(1505..1506)-, tdbSNP:35036421
complement(1536)-g, adbSNP:139111374
complement(1542)-t, cdbSNP:146168410
complement(1579)-t, cdbSNP:141525822
complement(1605)-g, adbSNP:140201906
complement(1614)-g, adbSNP:150688751
complement(1615)-t, cdbSNP:141959893
complement(1626)-t, gdbSNP:148132074
complement(1638)-g, adbSNP:143717216
complement(1715)-dbSNP:
complement(1715)-t, gdbSNP:143065311
complement(1729)-g, cdbSNP:139039794
complement(1750)-c, adbSNP:146461149
complement(1755)-t, gdbSNP:142337941
complement(1767)-c, adbSNP:201391449
complement(1772)-g, adbSNP:201086026
complement(1796)-dbSNP:
complement(1796)-t, cdbSNP:1804529
complement(1800)-g, adbSNP:202222787
complement(1905)-g, adbSNP:111435537
complement(1923)-g, adbSNP:61733324
complement(1935)-g, adbSNP:150161989
complement(1947)-g, adbSNP:151236625
complement(1959)-g, adbSNP:140842722
complement(2010)-t, gdbSNP:1804531
complement(2059)-dbSNP:
complement(2059)-g, cdbSNP:200982473
complement(2060)-g, adbSNP:199536347
complement(2062)-t, cdbSNP:201140985
complement(2063)-t, cdbSNP:201576970
complement(2067)-g, adbSNP:201562294
complement(2118)-t, cdbSNP:150975417
complement(2121)-t, cdbSNP:144048030
complement(2130)-t, cdbSNP:8782
complement(2135)-t, cdbSNP:146691736
complement(2153)-g, adbSNP:201873489
complement(2154)-t, cdbSNP:143199419
complement(2159)-g, adbSNP:148605258
complement(2239)-c, adbSNP:201024387
complement(2366)-dbSNP:
complement(2366)-g, adbSNP:144402543
complement(2377)-g, adbSNP:150052634
complement(2379)-g, adbSNP:139363416
complement(2404)-t, cdbSNP:200896348
complement(2410)-t, adbSNP:61733325
complement(2427)-dbSNP:
complement(2427)-t, cdbSNP:2229269
complement(2445)-t, cdbSNP:2229270
complement(2451)-t, cdbSNP:111867781
complement(2458)-t, cdbSNP:202236753
complement(2460)-g, adbSNP:2228172
complement(2475)-g, adbSNP:143208469
complement(2502)-g, adbSNP:201265824
complement(2523..2524)-, cdbSNP:34606017
complement(2529)-t, cdbSNP:111524366
complement(2550)-g, adbSNP:147941591
complement(2627)-dbSNP:
complement(2627)-t, cdbSNP:146295477
complement(2629)-t, cdbSNP:144142208
complement(2661)-dbSNP:
complement(2661)-t, cdbSNP:113310260
complement(2682)-t, gdbSNP:139183942
complement(2849)-, tdbSNP:142458504
complement(2862)-c, adbSNP:138753856
complement(2949)-c, adbSNP:10420
complement(2972)-t, cdbSNP:185957296
complement(2994)-t, gdbSNP:116016721
complement(3032)-g, cdbSNP:144840812
complement(3074)-c, adbSNP:815855
complement(3145..3146)-, gdbSNP:35737418
complement(3264)-t, gdbSNP:79157085
Gene SymbolTLE1
Gene SynonymESG; ESG1; GRG1
Chromosome9
Locus Map9q21.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005077 Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) (TLE1), mRNA. In-stock $809.00 $760.00 15
Title Multiple loci influencing hippocampal degeneration identified by genome scan .
Author Melville,S.A., Buros,J., Parrado,A.R., Vardarajan,B., Logue,M.W., Shen,L., Risacher,S.L., Kim,S., Jun,G., DeCarli,C., Lunetta,K.L., Baldwin,C.T., Saykin,A.J. and Farrer,L.A.
Journal Ann. Neurol. 72 (1), 65-75 (2012)
Title Transducin-like enhancer protein 1 mediates estrogen receptor binding and transcriptional activity in breast cancer cells .
Author Holmes,K.A., Hurtado,A., Brown,G.D., Launchbury,R., Ross-Innes,C.S., Hadfield,J., Odom,D.T. and Carroll,J.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (8), 2748-2753 (2012)
Title Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women .
Author Fox,C.S., Liu,Y., White,C.C., Feitosa,M., Smith,A.V., Heard-Costa,N., Lohman,K., Johnson,A.D., Foster,M.C., Greenawalt,D.M., Griffin,P., Ding,J., Newman,A.B., Tylavsky,F., Miljkovic,I., Kritchevsky,S.B., Launer,L., Garcia,M., Eiriksdottir,G., Carr,J.J., Gudnason,V., Harris,T.B., Cupples,L.A. and Borecki,I.B.
Journal PLoS Genet. 8 (5), E1002695 (2012)
Title TLE1 modifies the effects of NOD2 in the pathogenesis of Crohn's disease .
Author Nimmo,E.R., Stevens,C., Phillips,A.M., Smith,A., Drummond,H.E., Noble,C.L., Quail,M., Davies,G., Aldhous,M.C., Wilson,D.C. and Satsangi,J.
Journal Gastroenterology 141 (3), 972-981 (2011)
Title The role of TLE1 in synovial sarcoma .
Author Seo,S.W., Lee,H., Lee,H.I. and Kim,H.S.
Journal J. Orthop. Res. 29 (7), 1131-1136 (2011)
Title Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions .
Author Husain,J., Lo,R., Grbavec,D. and Stifani,S.
Journal Biochem. J. 317 (PT 2), 523-531 (1996)
Title Molecular interaction between TLE1 and the carboxyl-terminal domain of HES-1 containing the WRPW motif .
Author Grbavec,D. and Stifani,S.
Journal Biochem. Biophys. Res. Commun. 223 (3), 701-705 (1996)
Title Epithelial expression and chromosomal location of human TLE genes: implications for notch signaling and neoplasia .
Author Liu,Y., Dehni,G., Purcell,K.J., Sokolow,J., Carcangiu,M.L., Artavanis-Tsakonas,S. and Stifani,S.
Journal Genomics 31 (1), 58-64 (1996)
Title Molecular cloning and expression of mouse and human cDNA encoding .
Author Miyasaka,H., Choudhury,B.K., Hou,E.W. and Li,S.S.
Journal Eur. J. Biochem. 216 (1), 343-352 (1993)
Title Human homologs of a Drosophila Enhancer of split gene product define a novel family of nuclear proteins .
Author Stifani,S., Blaumueller,C.M., Redhead,N.J., Hill,R.E. and Artavanis-Tsakonas,S.
Journal Nat. Genet. 2 (2), 119-127 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.