• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens leucine-rich, glioma inactivated 1 (LGI1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19654 Homo sapiens leucine-rich, glioma inactivated 1 (LGI1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19654C Homo sapiens leucine-rich, glioma inactivated 1 (LGI1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005097.2, 171846229
Length 1674 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens leucine-rich, glioma inactivated 1 (LGI1), mRNA.
Product leucine-rich glioma-inactivated protein 1 precursor
Comment

Summary: This gene is rearranged as a result of translocations in glioblastoma cell lines. The protein contains a hydrophobic segment representing a putative transmembrane domain with the amino terminus located outside the cell. It also contains leucine-rich repeats with conserved cysteine-rich flanking sequences. This gene is predominantly expressed in neural tissues and its expression is reduced in low grade brain tumors and significantly reduced or absent in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. [provided by RefSeq, Jul 2008].

RefSeq NP_005088.1
CDS 337..2010
Misc Feature(1)211..213
Misc Feature(2)607..789
Misc Feature(3)610..675
Misc Feature(4)679..801
Misc Feature(5)682..747
Misc Feature(6)754..819
Misc Feature(7)853..999
Misc Feature(8)1006..1137
Misc Feature(9)1006..1137
Misc Feature(10)1144..1275
Misc Feature(11)1144..1275
Misc Feature(12)1282..1428
Misc Feature(13)1282..1428
Misc Feature(14)1429..1581
Misc Feature(15)1429..1578
Misc Feature(16)1588..1722
Misc Feature(17)1588..1722
Misc Feature(18)1723..1854
Misc Feature(19)1723..1854
Misc Feature(20)1861..1992
Misc Feature(21)1864..1983
Exon (1)1..551
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (2)552..623
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (3)624..695
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (4)696..767
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (5)768..839
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (6)840..1009
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (7)1010..1174
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Exon (8)1175..2366
Gene:LGI1
Gene Synonym:ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Translation MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVA QLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIY KWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQ PLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASS FKGNTQIYKHVIVDLSA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
57+dbSNP:
57+c, gdbSNP:74150339
110+c, tdbSNP:150194814
196+a, c, tdbSNP:112058882
330+a, cdbSNP:200602449
337+a, gdbSNP:202204627
411+c, gdbSNP:144700062
433+a, gdbSNP:371332661
472+c, tdbSNP:104894166
527+c, tdbSNP:373616721
541+a, gdbSNP:147469708
591+dbSNP:
591+a, gdbSNP:146224088
606+a, gdbSNP:139862877
612+a, gdbSNP:377278767
646+dbSNP:
646+a, gdbSNP:145675377
659+a, gdbSNP:368985089
681+a, gdbSNP:151104648
701+dbSNP:
701+a, tdbSNP:119488100
729+a, gdbSNP:199548601
734+a, gdbSNP:376452111
742+c, tdbSNP:119488099
822+dbSNP:
822+a, gdbSNP:139908142
827+a, cdbSNP:371135873
924+dbSNP:
924+a, gdbSNP:149816434
927+c, tdbSNP:145800952
936+c, tdbSNP:148862146
962+a, gdbSNP:370151711
978+c, gdbSNP:375446697
993+c, tdbSNP:1111820
996+c, tdbSNP:374811675
1020+dbSNP:
1020+g, tdbSNP:34490025
1031+c, tdbSNP:104894167
1053+a, cdbSNP:146425212
1080+a, gdbSNP:199916185
1092+c, tdbSNP:368264015
1104+c, tdbSNP:372978335
1148+c, tdbSNP:140752487
1161+c, tdbSNP:377206644
1207+dbSNP:
1207+a, tdbSNP:201081122
1209+c, tdbSNP:201947344
1289+g, tdbSNP:28939075
1355+c, tdbSNP:80194159
1402+c, tdbSNP:144905465
1411+a, gdbSNP:148263562
1417+a, cdbSNP:141334842
1442+c, tdbSNP:150357603
1458+c, tdbSNP:150515718
1484+a, cdbSNP:28937874
1491+a, cdbSNP:202148793
1505+c, tdbSNP:143152317
1556+a, gdbSNP:201376381
1621+a, gdbSNP:147473519
1626+a, gdbSNP:139879036
1635+c, tdbSNP:113679880
1652+c, tdbSNP:143808356
1654+a, gdbSNP:144400448
1678+c, tdbSNP:376203682
1704+a, gdbSNP:369166517
1728+a, gdbSNP:148804268
1819+a, gdbSNP:267602623
1863+c, tdbSNP:372810679
1917+c, tdbSNP:200329963
1925+c, tdbSNP:200600330
2005+a, gdbSNP:370955995
2061+a, gdbSNP:185233213
2225+c, tdbSNP:17502662
2348+a, gdbSNP:182654305
Gene SymbolLGI1
Gene SynonymADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Chromosome10
Locus Map10q24
Title Autoantibodies to epilepsy-related LGI1 in limbic encephalitis neutralize LGI1-ADAM22 interaction and reduce synaptic AMPA receptors .
Author Ohkawa T, Fukata Y, Yamasaki M, Miyazaki T, Yokoi N, Takashima H, Watanabe M, Watanabe O and Fukata M.
Journal J. Neurosci. 33 (46), 18161-18174 (2013)
Title Hyperactive behavior in a family with autosomal dominant lateral temporal lobe epilepsy caused by a mutation in the LGI1/epitempin gene .
Author Berghuis B, Brilstra EH, Lindhout D, Baulac S, de Haan GJ and van Kempen M.
Journal Epilepsy Behav 28 (1), 41-46 (2013)
Title Low penetrance of autosomal dominant lateral temporal epilepsy in Italian families without LGI1 mutations .
Author Michelucci R, Pasini E, Malacrida S, Striano P, Bonaventura CD, Pulitano P, Bisulli F, Egeo G, Santulli L, Sofia V, Gambardella A, Elia M, de Falco A, Neve Al, Banfi P, Coppola G, Avoni P, Binelli S, Boniver C, Pisano T, Marchini M, Dazzo E, Fanciulli M, Bartolini Y, Riguzzi P, Volpi L, de Falco FA, Giallonardo AT, Mecarelli O, Striano S, Tinuper P and Nobile C.
Journal Epilepsia 54 (7), 1288-1297 (2013)
Title Insights from LGI1 and CASPR2 potassium channel complex autoantibody subtyping .
Author Klein CJ, Lennon VA, Aston PA, McKeon A, O'Toole O, Quek A and Pittock SJ.
Journal JAMA Neurol 70 (2), 229-234 (2013)
Title Immunotherapy-responsive chorea as the presenting feature of LGI1-antibody encephalitis .
Author Tofaris GK, Irani SR, Cheeran BJ, Baker IW, Cader ZM and Vincent A.
Journal Neurology 79 (2), 195-196 (2012)
Title Mutations in the LGI1/Epitempin gene on 10q24 cause autosomal dominant lateral temporal epilepsy .
Author Morante-Redolat JM, Gorostidi-Pagola A, Piquer-Sirerol S, Saenz A, Poza JJ, Galan J, Gesk S, Sarafidou T, Mautner VF, Binelli S, Staub E, Hinzmann B, French L, Prud'homme JF, Passarelli D, Scannapieco P, Tassinari CA, Avanzini G, Marti-Masso JF, Kluwe L, Deloukas P, Moschonas NK, Michelucci R, Siebert R, Nobile C, Perez-Tur J and Lopez de Munain A.
Journal Hum. Mol. Genet. 11 (9), 1119-1128 (2002)
Title Mutations in LGI1 cause autosomal-dominant partial epilepsy with auditory features .
Author Kalachikov S, Evgrafov O, Ross B, Winawer M, Barker-Cummings C, Martinelli Boneschi F, Choi C, Morozov P, Das K, Teplitskaya E, Yu A, Cayanis E, Penchaszadeh G, Kottmann AH, Pedley TA, Hauser WA, Ottman R and Gilliam TC.
Journal Nat. Genet. 30 (3), 335-341 (2002)
Title A novel gene, LGI1, from 10q24 is rearranged and downregulated in malignant brain tumors .
Author Chernova OB, Somerville RP and Cowell JK.
Journal Oncogene 17 (22), 2873-2881 (1998)
Title Localization of a gene for partial epilepsy to chromosome 10q .
Author Ottman R, Risch N, Hauser WA, Pedley TA, Lee JH, Barker-Cummings C, Lustenberger A, Nagle KJ, Lee KS and Scheuer ML.
Journal Nat. Genet. 10 (1), 56-60 (1995)
Title Autosomal Dominant Partial Epilepsy with Auditory Features .
Author Ottman,R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.