• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20462 Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu20462C Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005105.4, 525345282
Length 525 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.
Product RNA-binding protein 8A
Comment

Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005096.1
CDS 111..635
Misc Feature(1)69..71
Misc Feature(2)114..116
Misc Feature(3)114..116
Misc Feature(4)180..182
Misc Feature(5)234..236
Misc Feature(6)234..236
Misc Feature(7)246..248
Misc Feature(8)<261..>554
Misc Feature(9)276..278
Misc Feature(10)309..563
Misc Feature(11)order(309..323,336..338,342..344,408..413,417..419,
Misc Feature(12)606..608
Misc Feature(13)612..614
Misc Feature(14)159..161
Exon (1)1..177
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (2)178..237
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (3)238..315
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (4)316..452
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (5)453..589
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (6)590..4961
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Translation MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
50+dbSNP:
50+a, gdbSNP:58332842
85+c, gdbSNP:370260423
90+a, gdbSNP:139428292
99+a, gdbSNP:149214780
152+c, tdbSNP:371420338
190+dbSNP:
190+a, gdbSNP:147545095
317..318+dbSNP:
317..318+, agcgdbSNP:397515388
350+c, tdbSNP:1806851
375+a, gdbSNP:201156815
428+c, tdbSNP:139097271
443+a, gdbSNP:370508792
494+dbSNP:
494+a, gdbSNP:373044482
507+a, gdbSNP:375471643
514+a, gdbSNP:144062976
536+a, gdbSNP:368483266
545+c, tdbSNP:143470048
597+dbSNP:
597+c, tdbSNP:397515389
628+a, gdbSNP:368052749
641+c, gdbSNP:12079762
641+c, gdbSNP:77434912
649+c, gdbSNP:374779697
660+c, gdbSNP:201860373
673+c, gdbSNP:372431424
681+c, tdbSNP:201038934
702+g, tdbSNP:142839636
736+c, tdbSNP:1048870
complement(743)-g, adbSNP:55781003
744+c, gdbSNP:113989026
827+a, tdbSNP:55897390
888..889+, tdbSNP:376280551
1016+c, tdbSNP:375871391
1055+a, gdbSNP:139217740
1487+a, cdbSNP:3768298
1722+g, tdbSNP:369921325
1784+c, tdbSNP:144112786
1800+a, gdbSNP:147038428
2187+c, tdbSNP:376065276
2199+c, tdbSNP:143120445
2324+g, tdbSNP:199817292
2328+c, gdbSNP:187831250
2345+c, g, tdbSNP:71664096
2417+c, tdbSNP:71664097
2524+c, tdbSNP:373864285
2562+a, gdbSNP:190627094
2636+c, tdbSNP:71664100
2655..2656+, ttcdbSNP:201357976
2773+g, tdbSNP:71664101
2781+a, tdbSNP:182869605
2851+g, tdbSNP:374153506
2869+a, tdbSNP:187878564
2873+g, tdbSNP:140286602
2959+c, gdbSNP:117371762
complement(2961)-g, adbSNP:34991188
3037+a, gdbSNP:144442231
3220+g, tdbSNP:72701871
3222..3223+, gdbSNP:66462664
3222+g, tdbSNP:199958689
3223+g, tdbSNP:201225488
3227+g, tdbSNP:202122090
3278+a, tdbSNP:77111400
3353+a, gdbSNP:191843738
3393+a, gdbSNP:3199206
3415+a, gdbSNP:184483533
3423+a, gdbSNP:3199208
3426+c, tdbSNP:187603182
3485+a, gdbSNP:192500658
3569..3570+, tgdbSNP:199854764
3576..3577+, adbSNP:34729420
3577..3578+, adbSNP:375737995
3585+a, tdbSNP:141029936
3588+a, tdbSNP:80094349
3590..3591+, adbSNP:147004767
3645..3646+, cdbSNP:35460165
3755+a, gdbSNP:76363180
3756+g, tdbSNP:74959119
3925+a, cdbSNP:150275951
4018+c, tdbSNP:185710141
4053+a, gdbSNP:190665108
4138+c, tdbSNP:112979084
4224+c, tdbSNP:138924552
4244+g, tdbSNP:376768749
4267+c, tdbSNP:371478482
4296+a, gdbSNP:1058565
4324+a, gdbSNP:184562575
4370+g, tdbSNP:188411357
4436+a, cdbSNP:181306508
4504+a, gdbSNP:148929877
4526+c, tdbSNP:147035532
complement(4574)-g, adbSNP:15502
complement(4578)-c, adbSNP:15590
4834+a, tdbSNP:185857658
4907+c, tdbSNP:77198650
Gene SymbolRBM8A
Gene SynonymBOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Chromosome1
Locus Map1q21.1
Title Slow co-evolution of the MAGO and Y14 protein families is required for the maintenance of their obligate heterodimerization mode .
Author Gong P, Zhao M and He C.
Journal PLoS ONE 9 (1), E84842 (2014)
Title Depletion of RNA-binding protein RBM8A (Y14) causes cell cycle deficiency and apoptosis in human cells .
Author Ishigaki Y, Nakamura Y, Tatsuno T, Hashimoto M, Shimasaki T, Iwabuchi K and Tomosugi N.
Journal Exp. Biol. Med. (Maywood) 238 (8), 889-897 (2013)
Title Y14 positively regulates TNF-alpha-induced NF-kappaB transcriptional activity via interacting RIP1 and TRADD beyond an exon junction complex protein .
Author Togi S, Shiga K, Muromoto R, Kato M, Souma Y, Sekine Y, Kon S, Oritani K and Matsuda T.
Journal J. Immunol. 191 (3), 1436-1444 (2013)
Title The RNA-binding protein Y14 inhibits mRNA decapping and modulates processing body formation .
Author Chuang TW, Chang WL, Lee KM and Tarn WY.
Journal Mol. Biol. Cell 24 (1), 1-13 (2013)
Title Compound inheritance of a low-frequency regulatory SNP and a rare null mutation in exon-junction complex subunit RBM8A causes TAR syndrome .
Author Albers CA, Paul DS, Schulze H, Freson K, Stephens JC, Smethurst PA, Jolley JD, Cvejic A, Kostadima M, Bertone P, Breuning MH, Debili N, Deloukas P, Favier R, Fiedler J, Hobbs CM, Huang N, Hurles ME, Kiddle G, Krapels I, Nurden P, Ruivenkamp CA, Sambrook JG, Smith K, Stemple DL, Strauss G, Thys C, van Geet C, Newbury-Ecob R, Ouwehand
Journal Nat. Genet. 44 (4), 435-439 (2012)
Title Identification and structural analysis of human RBM8A and RBM8B: two highly conserved RNA-binding motif proteins that interact with OVCA1, a candidate tumor suppressor .
Author Salicioni AM, Xi M, Vanderveer LA, Balsara B, Testa JR, Dunbrack RL Jr and Godwin AK.
Journal Genomics 69 (1), 54-62 (2000)
Title Cloning and gene expression of a novel human ribonucleoprotein .
Author Conklin DC, Rixon MW, Kuestner RE, Maurer MF, Whitmore TE and Millar RP.
Journal Biochim. Biophys. Acta 1492 (2-3), 465-469 (2000)
Title MAGOH interacts with a novel RNA-binding protein .
Author Zhao XF, Nowak NJ, Shows TB and Aplan PD.
Journal Genomics 63 (1), 145-148 (2000)
Title The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction .
Author Wilson KF, Fortes P, Singh US, Ohno M, Mattaj IW and Cerione RA.
Journal J. Biol. Chem. 274 (7), 4166-4173 (1999)
Title Thrombocytopenia Absent Radius Syndrome .
Author Toriello,H.V.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.