Search Tips

  • THAT   AND
  • THAT   AND


Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_005105 Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA. Full Lenth $1740.55
ORF Sequence $159.00


RefSeq Version NM_005105.3, 324120942
Length 4973 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.
Product RNA-binding protein 8A
Comment

Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene also uses multiple polyadenylation sites. [provided by RefSeq].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
RefSeq NP_005096.1
CDS 111..635
Exon (1)1..177
Exon (2)1..177
Exon (3)178..237
Exon (4)238..315
Exon (5)316..452
Exon (6)453..589
Exon (7)590..4960
Translation MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolRBM8A
Gene SynonymBOV-1A; BOV-1B; BOV-1C; MDS014; RBM8; RBM8B; Y14; ZNRP; ZRNP1
Chromosome1
Locus Map1q12
All Transcripts NM_005105
Title Disassembly of exon junction complexes by PYM .
Author Gehring,N.H., Lamprinaki,S., Kulozik,A.E. and Hentze,M.W.
Journal Cell 137 (3), 536-548 (2009)
Title The exon-junction complex proteins, Y14 and MAGOH regulate STAT3 activation .
Author Muromoto,R., Taira,N., Ikeda,O., Shiga,K., Kamitani,S., Togi,S., Kawakami,S., Sekine,Y., Nanbo,A., Oritani,K. and Matsuda,T.
Journal Biochem. Biophys. Res. Commun. 382 (1), 63-68 (2009)
Title An RNA biding protein, Y14 interacts with and modulates STAT3 activation .
Author Ohbayashi,N., Taira,N., Kawakami,S., Togi,S., Sato,N., Ikeda,O., Kamitani,S., Muromoto,R., Sekine,Y. and Matsuda,T.
Journal Biochem. Biophys. Res. Commun. 372 (3), 475-479 (2008)
Title Efficiency of the pioneer round of translation affects the cellular site of nonsense-mediated mRNA decay .
Author Sato,H., Hosoda,N. and Maquat,L.E.
Journal Mol. Cell 29 (2), 255-262 (2008)
Title PYM binds the cytoplasmic exon-junction complex and ribosomes to enhance translation of spliced mRNAs .
Author Diem,M.D., Chan,C.C., Younis,I. and Dreyfuss,G.
Journal Nat. Struct. Mol. Biol. 14 (12), 1173-1179 (2007)
Title Identification and structural analysis of human RBM8A and RBM8B: two highly conserved RNA-binding motif proteins that interact with OVCA1, a candidate tumor suppressor .
Author Salicioni,A.M., Xi,M., Vanderveer,L.A., Balsara,B., Testa,J.R., Dunbrack,R.L. Jr. and Godwin,A.K.
Journal Genomics 69 (1), 54-62 (2000)
Title Pre-mRNA splicing imprints mRNA in the nucleus with a novel RNA-binding protein that persists in the cytoplasm .
Author Kataoka,N., Yong,J., Kim,V.N., Velazquez,F., Perkinson,R.A., Wang,F. and Dreyfuss,G.
Journal Mol. Cell 6 (3), 673-682 (2000)
Title Cloning and gene expression of a novel human ribonucleoprotein .
Author Conklin,D.C., Rixon,M.W., Kuestner,R.E., Maurer,M.F., Whitmore,T.E. and Millar,R.P.
Journal Biochim. Biophys. Acta 1492 (2-3), 465-469 (2000)
Title MAGOH interacts with a novel RNA-binding protein .
Author Zhao,X.F., Nowak,N.J., Shows,T.B. and Aplan,P.D.
Journal Genomics 63 (1), 145-148 (2000)
Title The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction .
Author Wilson,K.F., Fortes,P., Singh,U.S., Ohno,M., Mattaj,I.W. and Cerione,R.A.
Journal J. Biol. Chem. 274 (7), 4166-4173 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878