• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.


RefSeq Accession Definition Services Price Order
NM_005105 Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005105.3, 324120942
Length 4973 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA.
Product RNA-binding protein 8A
Comment

Summary: This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene also uses multiple polyadenylation sites. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005096.1
CDS 111..635
Misc Feature(1)69..71
Misc Feature(2)114..116
Misc Feature(3)114..116
Misc Feature(4)159..161
Misc Feature(5)180..182
Misc Feature(6)234..236
Misc Feature(7)234..236
Misc Feature(8)246..248
Misc Feature(9)<261..>554
Misc Feature(10)276..278
Misc Feature(11)309..563
Misc Feature(12)order(309..323,336..338,342..344,408..413,417..419,
Misc Feature(13)606..608
Misc Feature(14)612..614
Exon (1)1..177
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (2)178..237
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (3)238..315
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (4)316..452
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (5)453..589
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Exon (6)590..4960
Gene:RBM8A
Gene Synonym:BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Translation MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
50+dbSNP:
50+a, gdbSNP:58332842
90+a, gdbSNP:139428292
99+a, gdbSNP:149214780
190+dbSNP:
190+a, gdbSNP:147545095
350+c, tdbSNP:1806851
375+a, gdbSNP:201156815
428+c, tdbSNP:139097271
514+dbSNP:
514+a, gdbSNP:144062976
545+c, tdbSNP:143470048
641+dbSNP:
641+c, gdbSNP:12079762
660+c, gdbSNP:201860373
681+c, tdbSNP:201038934
702+g, tdbSNP:142839636
736+c, tdbSNP:1048870
743+a, gdbSNP:55781003
744+c, gdbSNP:113989026
1055+a, gdbSNP:139217740
1288+a, gdbSNP:1254294
1487+a, cdbSNP:3768298
1602+a, gdbSNP:55887800
1619+a, tdbSNP:111805449
1783+c, gdbSNP:71664094
1784+c, tdbSNP:144112786
1800+a, gdbSNP:1058534
1800+a, gdbSNP:147038428
1941+c, gdbSNP:71664095
2177+c, gdbSNP:12886682
2199+c, tdbSNP:143120445
2214+a, gdbSNP:12886389
2324+g, tdbSNP:199817292
2328+c, gdbSNP:187831250
2345+c, g, tdbSNP:71664096
2417+c, tdbSNP:71664097
2562+a, gdbSNP:190627094
2636+c, tdbSNP:71664100
2655..2656+, ttcdbSNP:201357976
2773+g, tdbSNP:71664101
2781+a, tdbSNP:182869605
2869+a, tdbSNP:187878564
2873+g, tdbSNP:140286602
2959+c, gdbSNP:117371762
2961+a, gdbSNP:34991188
3037+a, gdbSNP:144442231
3220..3221+, gdbSNP:60403829
3220+g, tdbSNP:72701871
3221..3222+, gdbSNP:66462664
3221+g, tdbSNP:199958689
3222+g, tdbSNP:201225488
3226+g, tdbSNP:202122090
3277+a, tdbSNP:77111400
3352+a, gdbSNP:191843738
3392+a, gdbSNP:3199206
3414+a, gdbSNP:184483533
3422+a, gdbSNP:3199208
3425+c, tdbSNP:187603182
3484+a, gdbSNP:192500658
3568..3569+, tgdbSNP:199854764
3575..3576+, adbSNP:34729420
3576..3577+, adbSNP:147004767
3578..3579+, gdbSNP:11417018
3584+a, tdbSNP:141029936
3587+a, tdbSNP:80094349
3644..3645+, cdbSNP:35460165
3754+a, gdbSNP:76363180
3755+g, tdbSNP:74959119
3924+a, cdbSNP:150275951
4017+c, tdbSNP:185710141
4052+a, gdbSNP:190665108
4137+c, tdbSNP:112979084
4223+c, tdbSNP:138924552
4295+a, gdbSNP:1058565
4323+a, gdbSNP:184562575
4369+g, tdbSNP:188411357
4435+a, cdbSNP:181306508
4503+a, gdbSNP:148929877
4525+c, tdbSNP:147035532
4573+a, gdbSNP:15502
4577+a, cdbSNP:15590
4833+a, tdbSNP:185857658
4906+c, tdbSNP:77198650
Gene SymbolRBM8A
Gene SynonymBOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1
Chromosome1
Locus Map1q21.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005105 Homo sapiens RNA binding motif protein 8A (RBM8A), mRNA. Full Length $1740.55
ORF Sequence $159.00
Title Compound inheritance of a low-frequency regulatory SNP and a rare null mutation in exon-junction complex subunit RBM8A causes TAR syndrome .
Author Albers,C.A., Paul,D.S., Schulze,H., Freson,K., Stephens,J.C., Smethurst,P.A., Jolley,J.D., Cvejic,A., Kostadima,M., Bertone,P., Breuning,M.H., Debili,N., Deloukas,P., Favier,R., Fiedler,J., Hobbs,C.M., Huang,N., Hurles,M.E., Kiddle,G., Krapels,I., Nurden,P., Ruivenkamp,C.A., Sambrook,J.G., Smith,K., Stemple,D.L., Strauss,G., Thys,C., van Geet,C., Newbury-Ecob,R., Ouwehand,W.H. and Ghevaert,C.
Journal Nat. Genet. 44 (4), 435-439 (2012)
Title The exon junction complex component Y14 modulates the activity of the methylosome in biogenesis of spliceosomal small nuclear ribonucleoproteins .
Author Chuang,T.W., Peng,P.J. and Tarn,W.Y.
Journal J. Biol. Chem. 286 (11), 8722-8728 (2011)
Title SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay .
Author Yamashita,A., Izumi,N., Kashima,I., Ohnishi,T., Saari,B., Katsuhata,Y., Muramatsu,R., Morita,T., Iwamatsu,A., Hachiya,T., Kurata,R., Hirano,H., Anderson,P. and Ohno,S.
Journal Genes Dev. 23 (9), 1091-1105 (2009)
Title Disassembly of exon junction complexes by PYM .
Author Gehring,N.H., Lamprinaki,S., Kulozik,A.E. and Hentze,M.W.
Journal Cell 137 (3), 536-548 (2009)
Title The exon-junction complex proteins, Y14 and MAGOH regulate STAT3 activation .
Author Muromoto,R., Taira,N., Ikeda,O., Shiga,K., Kamitani,S., Togi,S., Kawakami,S., Sekine,Y., Nanbo,A., Oritani,K. and Matsuda,T.
Journal Biochem. Biophys. Res. Commun. 382 (1), 63-68 (2009)
Title Identification and structural analysis of human RBM8A and RBM8B: two highly conserved RNA-binding motif proteins that interact with OVCA1, a candidate tumor suppressor .
Author Salicioni,A.M., Xi,M., Vanderveer,L.A., Balsara,B., Testa,J.R., Dunbrack,R.L. Jr. and Godwin,A.K.
Journal Genomics 69 (1), 54-62 (2000)
Title Pre-mRNA splicing imprints mRNA in the nucleus with a novel RNA-binding protein that persists in the cytoplasm .
Author Kataoka,N., Yong,J., Kim,V.N., Velazquez,F., Perkinson,R.A., Wang,F. and Dreyfuss,G.
Journal Mol. Cell 6 (3), 673-682 (2000)
Title Cloning and gene expression of a novel human ribonucleoprotein .
Author Conklin,D.C., Rixon,M.W., Kuestner,R.E., Maurer,M.F., Whitmore,T.E. and Millar,R.P.
Journal Biochim. Biophys. Acta 1492 (2-3), 465-469 (2000)
Title MAGOH interacts with a novel RNA-binding protein .
Author Zhao,X.F., Nowak,N.J., Shows,T.B. and Aplan,P.D.
Journal Genomics 63 (1), 145-148 (2000)
Title The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction .
Author Wilson,K.F., Fortes,P., Singh,U.S., Ohno,M., Mattaj,I.W. and Cerione,R.A.
Journal J. Biol. Chem. 274 (7), 4166-4173 (1999)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878