• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28464 Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu28464C Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005141.4, 296080752
Length 1476 bp
Structure linear
Update Date 24-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA.
Product fibrinogen beta chain isoform 1 preproprotein
Comment

Summary: The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005132.2
CDS 40..1515
Misc Feature(1)31..33
Misc Feature(2)130..132
Misc Feature(3)169..174
Misc Feature(4)172..180
Misc Feature(5)307..744
Misc Feature(6)493..498
Misc Feature(7)517..522
Misc Feature(8)526..531
Misc Feature(9)751..1500
Misc Feature(10)1144..1146
Misc Feature(11)order(1270..1272,1276..1278,1282..1284)
Misc Feature(12)order(1309..1311,1318..1323,1348..1353)
Exon (1)1..153
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (2)154..345
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (3)346..529
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (4)530..757
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (5)758..871
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (6)872..997
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (7)998..1283
Gene:FGB
Gene Synonym:HEL-S-78p
Exon (8)1284..3628
Gene:FGB
Gene Synonym:HEL-S-78p
Translation MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM SMKIRPFFPQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
28+dbSNP:
28+a, cdbSNP:375151084
31+a, g, tdbSNP:113961753
complement(34)-t, cdbSNP:36203394
43+a, gdbSNP:6053
75+a, tdbSNP:376146726
118+c, tdbSNP:11099960
123+a, tdbSNP:375340782
169+dbSNP:
169+c, tdbSNP:121909616
172+g, tdbSNP:121909618
178+c, tdbSNP:121909625
180+a, gdbSNP:6059
214+c, tdbSNP:34851875
230+c, tdbSNP:141013999
239+c, gdbSNP:371842822
254+a, gdbSNP:144972538
259+c, tdbSNP:121909619
296+a, gdbSNP:11557357
330+c, tdbSNP:6060
331+a, gdbSNP:121909620
337+c, tdbSNP:2227434
348+dbSNP:
348+c, gdbSNP:145524939
349+a, gdbSNP:148864798
357+c, tdbSNP:6055
390+a, gdbSNP:199768390
406+a, gdbSNP:148045912
430+a, gdbSNP:142641543
515+a, tdbSNP:199596249
518+a, gdbSNP:113610714
547+dbSNP:
547+a, cdbSNP:2227409
549+a, tdbSNP:149963684
570+a, gdbSNP:201525782
573+c, gdbSNP:201909029
598+a, gdbSNP:377741367
606+c, tdbSNP:6056
613+c, gdbSNP:1043726
618+g, tdbSNP:141978904
625+c, tdbSNP:121909623
642+c, tdbSNP:150838423
644+a, tdbSNP:121909624
645+a, gdbSNP:1043727
664+a, cdbSNP:139311055
670+a, gdbSNP:374363120
721+a, gdbSNP:149599496
746+c, tdbSNP:144336893
785+dbSNP:
785+g, tdbSNP:369272403
801+a, gdbSNP:201536638
831+a, gdbSNP:199550432
833+c, tdbSNP:6054
834+a, gdbSNP:144912407
836+a, gdbSNP:370703973
855+g, tdbSNP:147961877
882+dbSNP:
882+g, tdbSNP:6058
900+c, tdbSNP:146831181
930+a, tdbSNP:199592944
933+a, gdbSNP:200755352
945+a, tdbSNP:142064127
964+a, tdbSNP:181245987
972+g, tdbSNP:151153332
990+c, tdbSNP:140191144
995+c, tdbSNP:374463429
1018+dbSNP:
1018+g, tdbSNP:368867072
1070+c, tdbSNP:150330219
1132+a, gdbSNP:121909617
1152+a, gdbSNP:6057
1156+a, tdbSNP:141025407
1164+c, tdbSNP:4681
1176+c, tdbSNP:371254124
1187+g, tdbSNP:121909621
1211+c, tdbSNP:138760475
1228+a, gdbSNP:200112613
1229+c, tdbSNP:62637604
1230+a, gdbSNP:140466984
1243+a, gdbSNP:200792588
1260+a, gdbSNP:143651398
1278+c, tdbSNP:148950857
1279+a, gdbSNP:141881199
1324+dbSNP:
1324+a, gdbSNP:199833798
1326+c, tdbSNP:369472452
1328+a, gdbSNP:121909622
1368+c, tdbSNP:150650205
1382+g, tdbSNP:199846554
1417+a, gdbSNP:200163097
1427+a, gdbSNP:112136436
1445+a, gdbSNP:202102031
1448+a, gdbSNP:374178110
1449+a, gdbSNP:113985604
1464+c, tdbSNP:139212482
1470+a, gdbSNP:201307744
1472+a, gdbSNP:4220
1525+c, gdbSNP:376861907
1530+a, gdbSNP:375561591
1564+a, gdbSNP:370076235
1778+a, gdbSNP:141024945
1864+a, gdbSNP:188621081
1885+c, tdbSNP:150273093
1888+a, gdbSNP:2227420
1924+c, tdbSNP:192770089
1937+a, cdbSNP:2227421
1958+a, gdbSNP:2227422
1962+c, tdbSNP:2227423
1965+a, tdbSNP:183181144
2003+a, cdbSNP:374456153
2023+g, tdbSNP:139295173
2107+a, gdbSNP:376470048
2134+c, tdbSNP:2227439
2168+a, cdbSNP:372503293
2201+a, gdbSNP:375313300
2333..2334+, adbSNP:368605323
2349+, adbSNP:57313183
2350+, gdbSNP:374552455
2433+c, gdbSNP:2227424
2433+c, gdbSNP:386496867
2463+a, gdbSNP:372231882
2585+c, gdbSNP:2227425
2594+a, cdbSNP:187861993
2884+a, gdbSNP:2227426
2887+a, tdbSNP:371670019
2936+c, tdbSNP:191481721
3032+c, tdbSNP:2059502
3065+c, tdbSNP:1044291
3132+a, tdbSNP:2059503
3132+a, tdbSNP:111198704
3251+c, tdbSNP:370220237
3267+g, tdbSNP:116381809
3271+g, tdbSNP:143937445
3365+a, cdbSNP:3183998
3493+c, tdbSNP:183622020
3503+a, tdbSNP:145761175
Gene SymbolFGB
Gene SynonymHEL-S-78p
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005141 Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_005141 Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Dermatopontin regulates fibrin formation and its biological activity .
Author Wu W, Okamoto O, Kato A, Matsuo N, Nomizu M, Yoshioka H and Fujiwara S.
Journal J. Invest. Dermatol. 134 (1), 256-263 (2014)
Title Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease .
Author Sabater-Lleal M, Huang J, Chasman D, Naitza S, Dehghan A, Johnson AD, Teumer A, Reiner AP, Folkersen L, Basu S, Rudnicka AR, Trompet S, Malarstig A, Baumert J, Bis JC, Guo X, Hottenga JJ, Shin SY, Lopez LM, Lahti J, Tanaka T, Yanek LR, Oudot-Mellakh T, Wilson JF, Navarro P, Huffman JE, Zemunik T, Redline S, Mehra R, Pulanic D, Rudan I, Wright AF, Kolcic I, Polasek O, Wild SH, Campbell H, Curb JD, Wallace R, Liu S, Eaton CB, Becker DM, Becker LC, Bandinelli S, Raikkonen K, Widen E, Palotie A, Fornage M, Green D, Gross M, Davies G, Harris SE, Liewald DC, Starr JM, Williams FM, Grant PJ, Spector TD, Strawbridge RJ, Silveira A, Sennblad B, Rivadeneira F, Uitterlinden AG, Franco OH, Hofman A, van Dongen J, Willemsen G, Boomsma DI, Yao J, Swords Jenny N, Haritunians T, McKnight B, Lumley T, Taylor KD, Rotter JI, Psaty BM, Peters A, Gieger C, Illig T, Grotevendt A, Homuth G, Volzke H, Kocher T, Goel A, Franzosi MG, Seedorf U, Clarke R, Steri M, Tarasov KV, Sanna S, Schlessinger D, Stott DJ, Sattar N, Buckley BM, Rumley A, Lowe GD, McArdle WL, Chen MH, Tofler GH, Song J, Boerwinkle E, Folsom AR, Rose LM, Franco-Cereceda A, Teichert M, Ikram MA, Mosley TH, Bevan S, Dichgans M, Rothwell PM, Sudlow CL, Hopewell JC, Chambers JC, Saleheen D, Kooner JS, Danesh J, Nelson CP, Erdmann J, Reilly MP, Kathiresan S, Schunkert H, Morange PE, Ferrucci L, Eriksson JG, Jacobs D, Deary IJ, Soranzo N, Witteman JC, de Geus EJ, Tracy RP, Hayward C, Koenig W, Cucca F, Jukema JW, Eriksson P, Seshadri S, Markus HS, Watkins H, Samani NJ, Wallaschofski H, Smith NL, Tregouet D, Ridker PM, Tang W, Strachan DP, Hamsten A and O'Donnell CJ.
Journal Circulation 128 (12), 1310-1324 (2013)
Title A study on human serum albumin influence on glycation of fibrinogen .
Author Kielmas M, Szewczuk Z and Stefanowicz P.
Journal Biochem. Biophys. Res. Commun. 439 (1), 78-83 (2013)
Title Stepwise assembly of fibrinogen is assisted by the endoplasmic reticulum lectin-chaperone system in HepG2 cells .
Author Tamura T, Arai S, Nagaya H, Mizuguchi J and Wada I.
Journal PLoS ONE 8 (9), E74580 (2013)
Title Fibrinogen and fibrin .
Author Doolittle,R.F.
Journal Annu. Rev. Biochem. 53, 195-229 (1984)
Title Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen .
Author Chung,D.W., Que,B.G., Rixon,M.W., Mace,M. Jr. and Davie,E.W.
Journal Biochemistry 22 (13), 3244-3250 (1983)
Title [Temperature-dependent changes in the profile of the sarcoplasmic reticulum membrane hydrophobic zones] .
Author Tarakhovskii,Iu.S., Galushchenko,I.V., Boroviagin,V.L., Ritov,V.B. and Komarov,P.G.
Journal Biokhimiia 44 (5), 897-902 (1979)
Title Amino acid sequence of the beta chain of human fibrinogen .
Author Watt,K.W., Takagi,T. and Doolittle,R.F.
Journal Biochemistry 18 (1), 68-76 (1979)
Title Primary structure of human fibrinogen. Characterization of disulfide-containing cyanogen-bromide fragments .
Author Gardlund,B., Hessel,B., Marguerie,G., Murano,G. and Blomback,B.
Journal Eur. J. Biochem. 77 (3), 595-610 (1977)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.