• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_005141 Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. ORF Sequence $428.04
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005141.4, 296080752
Length 3628 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA.
Product fibrinogen beta chain isoform 1 preproprotein
Comment

Summary: The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005132.2
CDS 40..1515
Misc Feature(1)31..33
Misc Feature(2)31..33
Misc Feature(3)130..132
Misc Feature(4)169..174
Misc Feature(5)172..180
Misc Feature(6)307..744
Misc Feature(7)493..498
Misc Feature(8)517..522
Misc Feature(9)526..531
Misc Feature(10)751..1500
Misc Feature(11)1144..1146
Misc Feature(12)order(1270..1272,1276..1278,1282..1284)
Misc Feature(13)order(1309..1311,1318..1323,1348..1353)
Exon (1)1..153
Gene:FGB
Gene Synonym:FGB
Exon (2)154..345
Gene:FGB
Gene Synonym:FGB
Exon (3)346..529
Gene:FGB
Gene Synonym:FGB
Exon (4)530..757
Gene:FGB
Gene Synonym:FGB
Exon (5)758..871
Gene:FGB
Gene Synonym:FGB
Exon (6)872..997
Gene:FGB
Gene Synonym:FGB
Exon (7)998..1283
Gene:FGB
Gene Synonym:FGB
Exon (8)1284..3628
Gene:FGB
Gene Synonym:FGB
Translation MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM SMKIRPFFPQQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
31+a, g, tdbSNP:113961753
34+c, tdbSNP:36203394
43+a, gdbSNP:6053
118+c, tdbSNP:11099960
169+dbSNP:
169+c, tdbSNP:121909616
172+g, tdbSNP:121909618
178+c, tdbSNP:121909625
180+a, gdbSNP:6059
214+c, tdbSNP:34851875
230+c, tdbSNP:141013999
254+a, gdbSNP:144972538
259+c, tdbSNP:121909619
287+a, gdbSNP:147556825
296+a, gdbSNP:11557357
330+c, tdbSNP:6060
331+a, gdbSNP:121909620
337+c, tdbSNP:2227434
348+dbSNP:
348+c, gdbSNP:145524939
349+a, gdbSNP:148864798
357+c, tdbSNP:6055
390+a, gdbSNP:199768390
406+a, gdbSNP:148045912
430+a, gdbSNP:142641543
515+a, tdbSNP:199596249
518+a, gdbSNP:113610714
547+dbSNP:
547+a, cdbSNP:2227409
549+a, tdbSNP:149963684
570+a, gdbSNP:201525782
573+c, gdbSNP:201909029
603+c, tdbSNP:144915882
606+c, tdbSNP:6056
613+c, gdbSNP:1043726
618+g, tdbSNP:141978904
625+c, tdbSNP:121909623
642+c, tdbSNP:150838423
644+a, tdbSNP:121909624
645+a, gdbSNP:1043727
664+a, cdbSNP:139311055
721+a, gdbSNP:149599496
746+c, tdbSNP:144336893
801+dbSNP:
801+a, gdbSNP:201536638
831+a, gdbSNP:199550432
833+c, tdbSNP:6054
834+a, gdbSNP:144912407
855+g, tdbSNP:147961877
882+dbSNP:
882+g, tdbSNP:6058
900+c, tdbSNP:146831181
930+a, tdbSNP:199592944
933+a, gdbSNP:200755352
945+a, tdbSNP:142064127
964+a, tdbSNP:181245987
972+g, tdbSNP:151153332
990+c, tdbSNP:140191144
1070+c, tdbSNP:150330219
1132+a, gdbSNP:121909617
1152+a, gdbSNP:6057
1156+a, tdbSNP:141025407
1164+c, tdbSNP:4681
1187+g, tdbSNP:121909621
1211+c, tdbSNP:138760475
1228+a, gdbSNP:200112613
1229+c, tdbSNP:62637604
1230+a, gdbSNP:140466984
1243+a, gdbSNP:200792588
1260+a, gdbSNP:143651398
1278+c, tdbSNP:148950857
1279+a, gdbSNP:141881199
1324+dbSNP:
1324+a, gdbSNP:199833798
1328+a, gdbSNP:121909622
1368+c, tdbSNP:150650205
1382+g, tdbSNP:199846554
1417+a, gdbSNP:200163097
1427+a, gdbSNP:112136436
1445+a, gdbSNP:202102031
1449+a, gdbSNP:113985604
1464+c, tdbSNP:139212482
1470+a, gdbSNP:201307744
1472+a, gdbSNP:4220
1778+a, gdbSNP:141024945
1864+a, gdbSNP:188621081
1885+c, tdbSNP:150273093
1888+a, gdbSNP:2227420
1924+c, tdbSNP:192770089
1937+a, cdbSNP:2227421
1958+a, gdbSNP:2227422
1962+c, tdbSNP:2227423
1965+a, tdbSNP:183181144
2023+g, tdbSNP:139295173
2134+c, tdbSNP:2227439
2333+, cadbSNP:75820259
2349+, a, aaadbSNP:57313183
2433+c, gdbSNP:2227424
2585+c, gdbSNP:2227425
2594+a, cdbSNP:187861993
2884+a, gdbSNP:2227426
2936+c, tdbSNP:191481721
3032+c, tdbSNP:2059502
3065+c, tdbSNP:1044291
3132+a, tdbSNP:2059503
3267+g, tdbSNP:116381809
3271+g, tdbSNP:143937445
3365+a, cdbSNP:3183998
3493+c, tdbSNP:183622020
3503+a, tdbSNP:145761175
Gene SymbolFGB
Gene SynonymFGB
Chromosome4
Locus Map4q28
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001184741 Homo sapiens fibrinogen beta chain (FGB), transcript variant 2, mRNA. Full Length $1207.85
ORF Sequence $376.71
NM_005141 Homo sapiens fibrinogen beta chain (FGB), transcript variant 1, mRNA. Full Length $1269.80
ORF Sequence $428.04
Title Clinical phenotype, laboratory features and genotype of 35 patients with heritable dysfibrinogenaemia .
Author Shapiro,S.E., Phillips,E., Manning,R.A., Morse,C.V., Murden,S.L., Laffan,M.A. and Mumford,A.D.
Journal Br. J. Haematol. 160 (2), 220-227 (2013)
Title Fibrinogen gene regulation .
Author Fish,R.J. and Neerman-Arbez,M.
Journal Thromb. Haemost. 108 (3), 419-426 (2012)
Title [Polymorphic variants of genes encoding interleukin-6 and fibrinogen, the risk of ischemic stroke and fibrinogen levels] .
Author Titov,B.V., Barsova,R.M., Martynov,M.Iu., Nikonova,A.A., Favorov,A.V., Gusev,E.I. and Favorova,O.O.
Journal Mol. Biol. (Mosk.) 46 (1), 93-102 (2012)
Title PDGF suppresses the sulfation of CD44v and potentiates CD44v-mediated binding of colon carcinoma cells to fibrin under flow .
Author Alves,C.S. and Konstantopoulos,K.
Journal PLoS ONE 7 (10), E41472 (2012)
Title Fibrinogen and fibrin .
Author Doolittle,R.F.
Journal Annu. Rev. Biochem. 53, 195-229 (1984)
Title Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen .
Author Chung,D.W., Que,B.G., Rixon,M.W., Mace,M. Jr. and Davie,E.W.
Journal Biochemistry 22 (13), 3244-3250 (1983)
Title [Temperature-dependent changes in the profile of the sarcoplasmic reticulum membrane hydrophobic zones] .
Author Tarakhovskii,Iu.S., Galushchenko,I.V., Boroviagin,V.L., Ritov,V.B. and Komarov,P.G.
Journal Biokhimiia 44 (5), 897-902 (1979)
Title Amino acid sequence of the beta chain of human fibrinogen .
Author Watt,K.W., Takagi,T. and Doolittle,R.F.
Journal Biochemistry 18 (1), 68-76 (1979)
Title Primary structure of human fibrinogen. Characterization of disulfide-containing cyanogen-bromide fragments .
Author Gardlund,B., Hessel,B., Marguerie,G., Murano,G. and Blomback,B.
Journal Eur. J. Biochem. 77 (3), 595-610 (1977)
Title Disulfide bridges in nh2 -terminal part of human fibrinogen .
Author Blomback,B., Hessel,B. and Hogg,D.
Journal Thromb. Res. 8 (5), 639-658 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878