Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 2 (ABL2), transcript variant c, mRNA.

Summary
Sequence
Translation
SNP
Other Variants
PubMed

RefSeq Version	NM_005158.4, 269847767
Length	11957 bp
Structure	linear
Update Date	24-APR-2011
Organism	Homo sapiens (human)
Definition	Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 2 (ABL2), transcript variant c, mRNA.
Product	tyrosine-protein kinase ABL2 isoform c
Comment	Summary: This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinases. The protein is highly similar to the c-abl oncogene 1 protein, including the tyrosine kinase, SH2 and SH3 domains, and it plays a role in cytoskeletal rearrangements through its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ets variant 6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (c) differs in the 5' UTR and 5' coding region, compared to variant b, resulting in an isoform (c, also known as 1ALCTL) with a distinct and shorter N-terminus, compared to isoform b. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq	NP_005149.4
CDS	46..3549
Exon (1)	1..157
Exon (2)	1..157
Exon (3)	158..220
Exon (4)	221..391
Exon (5)	392..687
Exon (6)	688..960
Exon (7)	961..1045
Exon (8)	1046..1223
Exon (9)	1224..1408
Exon (10)	1409..1561
Exon (11)	1562..1651
Exon (12)	1652..1825
Exon (13)	1826..11940
Translation	MVLGTVLLPPNSYGRDQDTSLCCLCTEASESALPDLTDHFASCVEDGFEGDKTGGSSPEA LHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLR VLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSF LVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGL VTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVA VKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRE CNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMT GDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVY DLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEE LGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQ ASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREM ENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGG GGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQD RMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPR GATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPS PAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRP RRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGK AGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADL LSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSA AAGVPGTNPVLNNLLSCVQEISDVVQR Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.

Position	Chain	Variation	Link
complement(80)	-	g, c	dbSNP:1318056
complement(233)	-	t, c	dbSNP:55655202
complement(464)	-	c, a	dbSNP:61821670
complement(505..506)	-	, t	dbSNP:35945588
complement(650)	-	g, a	dbSNP:112007604
651	+	a, g	dbSNP:28914528
complement(909)	-	g, a	dbSNP:56032037
939	+	a, g	dbSNP:28914532
955	+	c, t	dbSNP:28914533
1494	+	a, c	dbSNP:2274230
2058	+	g, t	dbSNP:28913887
complement(2153..2154)	-	, c	dbSNP:67764190
2190	+	c, t	dbSNP:28913888
complement(2236)	-	c, a	dbSNP:78418476
complement(2350)	-	t, a	dbSNP:55892721
complement(2625)	-	g, a	dbSNP:61731092
complement(2649)	-	t, c	dbSNP:77598575
complement(2666)	-	, t	dbSNP:34839060
complement(2789)	-	t, c	dbSNP:17277288
2836	+	a, g	dbSNP:28913889
complement(2844)	-	g, a	dbSNP:35124879
2987	+	c, g	dbSNP:28913890
complement(3168)	-	t, g	dbSNP:74835127
3254	+	a, g	dbSNP:28913891
3301	+	a, g	dbSNP:28913892
3581	+	c, t	dbSNP:28913893
3722	+	a, g	dbSNP:2298067
3730	+	c, t	dbSNP:28913894
complement(3814)	-	t, c	dbSNP:12129574
4152	+	c, t	dbSNP:2298068
4238	+	a, g	dbSNP:28913895
4577	+	c, t	dbSNP:28913896
complement(4580)	-	, c	dbSNP:34688224
complement(4632)	-	g, a	dbSNP:74737297
4647	+	c, t	dbSNP:1490311
complement(4683)	-	t, a	dbSNP:77298709
complement(4728..4729)	-	, g	dbSNP:66639438
4778	+	c, g	dbSNP:28913897
4874	+	a, g	dbSNP:28913898
complement(5088)	-	g, a	dbSNP:112121554
5290	+	a, g	dbSNP:28913899
5317	+	a, g	dbSNP:28913900
complement(5533)	-	t, g	dbSNP:10913692
complement(5606)	-	t, c	dbSNP:12072619
complement(5631)	-	t, c	dbSNP:9729162
complement(5803)	-	c, a	dbSNP:117228532
complement(5805)	-	t, c	dbSNP:114423722
complement(6066)	-	c, a	dbSNP:116742058
complement(6142)	-	t, c	dbSNP:74131925
complement(6473)	-	g, a	dbSNP:112527833
complement(6603)	-	t, c	dbSNP:12759699
complement(7036)	-	t, a	dbSNP:116048422
complement(7170)	-	t, g	dbSNP:60121043
complement(7206)	-	t, c	dbSNP:12569049
complement(7327)	-	t, c	dbSNP:16853672
complement(7363)	-	g, c	dbSNP:4651014
complement(7436)	-	t, c	dbSNP:4651013
complement(7674)	-	t, c	dbSNP:3829794
complement(7778)	-	g, a	dbSNP:75390485
complement(8107)	-	t, c	dbSNP:78206228
complement(8188)	-	t, g	dbSNP:116676084
8484	+	a, c	dbSNP:1325194
complement(8537)	-	g, a	dbSNP:4651012
complement(8610)	-	g, c	dbSNP:115727481
8646	+	c, t	dbSNP:1325195
complement(8672)	-	g, a	dbSNP:117848741
complement(9075..9076)	-	, tt	dbSNP:71845680
complement(9081..9082)	-	, gt	dbSNP:71796222
9236..9242	+	, aaaaaaa	dbSNP:71108092
complement(9245)	-	, ttttttt	dbSNP:71990363
complement(9247)	-	, ttttttt	dbSNP:71912740
complement(9274)	-	t, a	dbSNP:74571115
complement(9276)	-	t, a	dbSNP:80017955
complement(9365)	-	g, a	dbSNP:17361990
complement(9465)	-	g, c	dbSNP:76656490
complement(9487)	-	g, c	dbSNP:34112331
9875..9876	+	, a	dbSNP:71108091
complement(9875)	-	t, c	dbSNP:75775923
complement(9877)	-	t, c	dbSNP:75924826
complement(9883..9884)	-	, t	dbSNP:72025934
complement(9888..9889)	-	, t	dbSNP:72205435
complement(9888)	-	t, c	dbSNP:77578072
complement(9889..9890)	-	, t	dbSNP:111283961
complement(9890)	-	t, c	dbSNP:78951029
complement(9891)	-	t, c	dbSNP:61821666
complement(9896)	-	g, a	dbSNP:78610294
complement(9953)	-	t, g	dbSNP:118129417
complement(10065)	-	c, a	dbSNP:78544564
complement(10068)	-	g, c	dbSNP:3813643
complement(10073)	-	c, a	dbSNP:116004611
complement(10215)	-	g, a	dbSNP:79464508
complement(10282)	-	t, c	dbSNP:3813642
complement(10423)	-	c, a	dbSNP:111495165
complement(10675)	-	t, c	dbSNP:73049409
complement(10837)	-	g, a	dbSNP:16853669
10950	+	c, t	dbSNP:1044952
10973	+	a, g	dbSNP:3210839
complement(11035)	-	t, c	dbSNP:77457023
complement(11196)	-	g, c	dbSNP:80122319
complement(11540)	-	t, c	dbSNP:114406329
complement(11551)	-	g, a	dbSNP:9662858
complement(11739)	-	g, a	dbSNP:112846260
11782	+	a, t	dbSNP:1044972
complement(11790)	-	t, c	dbSNP:112187916

Gene Symbol	ABL2
Gene Synonym	ABLL; ARG; FLJ22224; FLJ31718; FLJ41441
Chromosome	1
Locus Map	1q25.2
All Transcripts	NM_001136001 , NM_007314 , NM_005158 , NM_001136000 , NM_001168236 , NM_001168237 , NM_001168238 , NM_001168239

Title	An EGFR-Src-Arg-cortactin pathway mediates functional maturation of invadopodia and breast cancer cell invasion .
Author	Mader,C.C., Oser,M., Magalhaes,M.A., Bravo-Cordero,J.J., Condeelis,J., Koleske,A.J. and Gil-Henn,H.
Journal	Cancer Res. 71 (5), 1730-1741 (2011)
Title	Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author	Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A.
Journal	Mutat. Res. 694 (1-2), 13-19 (2010)
Title	Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author	Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal	Diabetes Care 33 (10), 2250-2253 (2010)
Title	Successful treatment using omacetaxine for a patient with CML and BCR-ABL1 [corrected] 35INS .
Author	Mahadeo,K.M. and Cole,P.D.
Journal	Blood 115 (18), 3852 (2010)
Title	Eight full-length abelson related gene (Arg) isoforms are constitutively expressed in caki-1 cell line and cell distribution of two isoforms has been analyzed after transfection .
Author	Bianchi,C., Torsello,B., Angeloni,V., Bombelli,S., Soldi,M., Invernizzi,L., Brambilla,P. and Perego,R.A.
Journal	J. Cell. Biochem. 105 (5), 1219-1227 (2008)
Title	N- and C-terminal isoforms of Arg quantified by real-time PCR are specifically expressed in human normal and neoplastic cells, in neoplastic cell lines, and in HL-60 cell differentiation .
Author	Perego,R.A., Corizzato,M., Bianchi,C., Eroini,B. and Bosari,S.
Journal	Mol. Carcinog. 42 (4), 229-239 (2005)
Title	Subcellular localization of the Arg protein tyrosine kinase .
Author	Wang,B. and Kruh,G.D.
Journal	Oncogene 13 (1), 193-197 (1996)
Title	A limited set of SH2 domains binds BCR through a high-affinity phosphotyrosine-independent interaction .
Author	Muller,A.J., Pendergast,A.M., Havlik,M.H., Puil,L., Pawson,T. and Witte,O.N.
Journal	Mol. Cell. Biol. 12 (11), 5087-5093 (1992)
Title	The complete coding sequence of arg defines the Abelson subfamily of cytoplasmic tyrosine kinases .
Author	Kruh,G.D., Perego,R., Miki,T. and Aaronson,S.A.
Journal	Proc. Natl. Acad. Sci. U.S.A. 87 (15), 5802-5806 (1990)
Title	A novel human gene closely related to the abl proto-oncogene .
Author	Kruh,G.D., King,C.R., Kraus,M.H., Popescu,N.C., Amsbaugh,S.C., McBride,W.O. and Aaronson,S.A.
Journal	Science 234 (4783), 1545-1548 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

	Secured Online Quotation
	Email: gene@genscript.com
	Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
	Fax: 1-732-210-0262 1-732-885-5878

RefSeq Accession	Definition	Sequence	Price	Select
NM_005158	Homo sapiens v-abl Abelson murine leukemia viral oncogene homolog 2 (ABL2), transcript variant c, mRNA.	Full Lenth	Quote
NM_005158		ORF Sequence	$1226.40