• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens apelin receptor (APLNR), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005161 Homo sapiens apelin receptor (APLNR), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_005161.4, 253314537
Length 3905 bp
Structure linear
Update Date 26-MAR-2013
Organism Homo sapiens (human)
Definition Homo sapiens apelin receptor (APLNR), transcript variant 1, mRNA.
Product apelin receptor
Comment

Summary: This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the functional protein.

RefSeq NP_005152.1
CDS 450..1592
Misc Feature(1)348..350
Misc Feature(2)528..602
Misc Feature(3)528..602
Misc Feature(4)606..1376
Misc Feature(5)648..722
Misc Feature(6)750..824
Misc Feature(7)882..947
Misc Feature(8)1050..1112
Misc Feature(9)1182..1262
Misc Feature(10)1302..1373
Exon (1)1..3877
Gene:APLNR
Gene Synonym:AGTRL1; APJ; APJR; HG11
Translation MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK GGEQMHEKSIPYSQETLVVD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(21)-dbSNP:
complement(21)-g, cdbSNP:74349565
complement(79)-t, gdbSNP:2510358
complement(132)-t, cdbSNP:185056903
complement(269)-g, adbSNP:78133850
complement(276)-g, adbSNP:116563402
complement(351)-g, adbSNP:11544374
complement(355)-g, cdbSNP:146817171
complement(374)-c, adbSNP:181683621
complement(422)-g, adbSNP:116790301
complement(429)-t, cdbSNP:190358352
complement(491)-g, adbSNP:184417795
complement(530)-c, adbSNP:201644557
complement(561)-t, cdbSNP:192352340
complement(563)-g, adbSNP:144689296
complement(584)-t, gdbSNP:948847
complement(587)-g, adbSNP:138964036
complement(606)-t, cdbSNP:145108815
complement(612)-g, adbSNP:200201854
complement(633)-g, adbSNP:142394789
complement(683)-g, adbSNP:138423122
complement(684)-t, cdbSNP:144634263
complement(720)-g, adbSNP:200935550
complement(752)-g, adbSNP:140789646
complement(797)-g, adbSNP:150922621
complement(812)-g, adbSNP:77731345
complement(877)-t, cdbSNP:200833984
complement(914)-c, adbSNP:142528840
complement(923)-g, adbSNP:148897314
complement(982)-t, cdbSNP:200422749
complement(989)-t, cdbSNP:147862659
complement(1039)-t, cdbSNP:201345085
complement(1043)-t, cdbSNP:61731623
complement(1060)-g, adbSNP:202019294
complement(1121)-g, adbSNP:144399813
complement(1123)-g, adbSNP:140463390
complement(1133)-t, gdbSNP:202065184
complement(1146)-g, adbSNP:200672348
complement(1147)-t, cdbSNP:147193169
complement(1156)-c, adbSNP:199589565
complement(1170)-g, adbSNP:150001803
complement(1171)-t, cdbSNP:139313864
complement(1179)-g, adbSNP:150819843
complement(1244)-g, adbSNP:141428436
complement(1245)-g, cdbSNP:192803923
complement(1255)-g, adbSNP:140178173
complement(1256)-c, adbSNP:146141809
complement(1257)-g, adbSNP:143066273
complement(1262)-g, adbSNP:138393860
complement(1293)-c, adbSNP:143772778
complement(1333)-t, gdbSNP:200012705
complement(1344)-g, adbSNP:187940540
complement(1347)-t, cdbSNP:7943508
complement(1392)-g, cdbSNP:137997556
complement(1399)-t, cdbSNP:200854787
complement(1424)-g, adbSNP:147695707
complement(1447)-c, adbSNP:140133715
complement(1508)-t, cdbSNP:147773675
complement(1528)-t, cdbSNP:146062493
complement(1547)-g, adbSNP:142294759
complement(1617)-g, adbSNP:200674887
complement(1618)-t, cdbSNP:147023435
complement(1628)-g, cdbSNP:201061974
complement(1644)-t, gdbSNP:148940731
complement(1855)-t, cdbSNP:149753797
complement(1947)-g, adbSNP:139642553
complement(1965)-g, adbSNP:145342843
complement(1973)-t, cdbSNP:183404693
complement(2018)-g, adbSNP:114855852
complement(2041)-g, adbSNP:191489134
complement(2086)-, adbSNP:201921146
complement(2197)-g, adbSNP:187416885
complement(2198)-t, cdbSNP:146477561
complement(2423)-c, adbSNP:12270028
complement(2509..2510)-, ccdbSNP:35575353
complement(2527)-t, gdbSNP:183070437
complement(2547)-g, adbSNP:190853362
complement(2602)-t, gdbSNP:186589369
complement(2681)-g, adbSNP:746887
complement(2705)-g, cdbSNP:199976787
complement(2706..2709)-, cacadbSNP:76884556
complement(2707..2710)-, acacdbSNP:140473375
complement(2707)-, gtgtdbSNP:35099041
complement(2707)-c, adbSNP:201425807
complement(2711..2714)-, tacadbSNP:201460502
complement(2737)-g, adbSNP:180847152
complement(2777)-g, adbSNP:948846
complement(2817)-g, adbSNP:746886
complement(2860)-t, cdbSNP:77455594
complement(2896)-g, adbSNP:746885
complement(2944)-t, cdbSNP:191173555
complement(3000)-g, adbSNP:2282625
complement(3017)-t, cdbSNP:2282624
complement(3028)-g, adbSNP:112886081
complement(3070)-t, cdbSNP:139151244
complement(3102)-t, cdbSNP:2282623
complement(3110)-g, adbSNP:186275554
complement(3111)-g, adbSNP:146227727
complement(3112)-g, adbSNP:181183506
complement(3129)-t, cdbSNP:189652906
complement(3147)-t, cdbSNP:79024304
complement(3170)-g, adbSNP:184192451
complement(3218)-g, adbSNP:76744986
complement(3318)-c, adbSNP:1044235
complement(3344)-c, adbSNP:141146477
complement(3365)-t, cdbSNP:181557519
complement(3401)-g, adbSNP:148620821
complement(3509)-g, adbSNP:144828425
complement(3510)-t, cdbSNP:189300871
complement(3623)-g, adbSNP:76463472
complement(3793)-t, cdbSNP:3177149
complement(3822..3823)-, gdbSNP:35899316
Gene SymbolAPLNR
Gene SynonymAGTRL1; APJ; APJR; HG11
Chromosome11
Locus Map11q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005161 Homo sapiens apelin receptor (APLNR), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title Apelin/APJ signaling is a critical regulator of statin effects in vascular endothelial cells--brief report .
Author McLean,D.L., Kim,J., Kang,Y., Shi,H., Atkins,G.B., Jain,M.K. and Chun,H.J.
Journal Arterioscler. Thromb. Vasc. Biol. 32 (11), 2640-2643 (2012)
Title The apelin/APJ system induces maturation of the tumor vasculature and improves the efficiency of immune therapy .
Author Kidoya,H., Kunii,N., Naito,H., Muramatsu,F., Okamoto,Y., Nakayama,T. and Takakura,N.
Journal Oncogene 31 (27), 3254-3264 (2012)
Title APELIN promotes hematopoiesis from human embryonic stem cells .
Author Yu,Q.C., Hirst,C.E., Costa,M., Ng,E.S., Schiesser,J.V., Gertow,K., Stanley,E.G. and Elefanty,A.G.
Journal Blood 119 (26), 6243-6254 (2012)
Title APJ polymorphisms in coronary artery disease patients with and without hypertension .
Author Falcone,C., Bozzini,S., Schirinzi,S., Buzzi,M.P., Boiocchi,C., Totaro,R., Bondesan,M. and Pelissero,G.
Journal Mol Med Rep 5 (2), 321-325 (2012)
Title Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin .
Author Medhurst,A.D., Jennings,C.A., Robbins,M.J., Davis,R.P., Ellis,C., Winborn,K.Y., Lawrie,K.W., Hervieu,G., Riley,G., Bolaky,J.E., Herrity,N.C., Murdock,P. and Darker,J.G.
Journal J. Neurochem. 84 (5), 1162-1172 (2003)
Title [(125)I]-(Pyr(1))Apelin-13 is a novel radioligand for localizing the APJ orphan receptor in human and rat tissues with evidence for a vasoconstrictor role in man .
Author Katugampola,S.D., Maguire,J.J., Matthewson,S.R. and Davenport,A.P.
Journal Br. J. Pharmacol. 132 (6), 1255-1260 (2001)
Title Distribution of mRNA encoding B78/apj, the rat homologue of the human APJ receptor, and its endogenous ligand apelin in brain and peripheral tissues .
Author O'Carroll,A.M., Selby,T.L., Palkovits,M. and Lolait,S.J.
Journal Biochim. Biophys. Acta 1492 (1), 72-80 (2000)
Title Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor .
Author Tatemoto,K., Hosoya,M., Habata,Y., Fujii,R., Kakegawa,T., Zou,M.X., Kawamata,Y., Fukusumi,S., Hinuma,S., Kitada,C., Kurokawa,T., Onda,H. and Fujino,M.
Journal Biochem. Biophys. Res. Commun. 251 (2), 471-476 (1998)
Title Low stringency hybridization study of the dopamine D4 receptor revealed D4-like mRNA distribution of the orphan seven-transmembrane receptor, APJ, in human brain .
Author Matsumoto,M., Hidaka,K., Akiho,H., Tada,S., Okada,M. and Yamaguchi,T.
Journal Neurosci. Lett. 219 (2), 119-122 (1996)
Title A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11 .
Author O'Dowd,B.F., Heiber,M., Chan,A., Heng,H.H., Tsui,L.C., Kennedy,J.L., Shi,X., Petronis,A., George,S.R. and Nguyen,T.
Journal Gene 136 (1-2), 355-360 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.