• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005163 Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_005163.2, 62241010
Length 3008 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA.
Product RAC-alpha serine/threonine-protein kinase
Comment

Summary: The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011].


Transcript Variant: This variant (1) is the longest transcript. Variants 1, 2 and 3 encode the same protein.

RefSeq NP_005154.2
CDS 555..1997
Misc Feature(1)516..518
Misc Feature(2)570..887
Misc Feature(3)570..887
Misc Feature(4)order(594..596,600..611,621..623,627..629,708..713,
Misc Feature(5)594..611
Misc Feature(6)594..596
Misc Feature(7)612..614
Misc Feature(8)621..629
Misc Feature(9)924..926
Misc Feature(10)924..926
Misc Feature(11)930..932
Misc Feature(12)930..932
Misc Feature(13)939..941
Misc Feature(14)939..941
Misc Feature(15)1002..1778
Misc Feature(16)1014..1985
Misc Feature(17)order(1020..1025,1029..1034,1044..1046,1083..1085,
Misc Feature(18)order(1020..1025,1029..1031,1044..1046,1083..1085,
Misc Feature(19)order(1032..1034,1125..1127,1134..1136,1254..1256,
Misc Feature(20)1080..1082
Misc Feature(21)1236..1244
Misc Feature(22)1425..1496
Misc Feature(23)1476..1478
Misc Feature(24)1476..1478
Misc Feature(25)1476..1478
Misc Feature(26)1476..1478
Misc Feature(27)1476..1478
Misc Feature(28)1476..1478
Misc Feature(29)1497..1499
Misc Feature(30)1530..1532
Misc Feature(31)1902..1904
Misc Feature(32)1902..1904
Misc Feature(33)1938..1940
Misc Feature(34)1959..1976
Misc Feature(35)1971..1973
Misc Feature(36)1971..1973
Misc Feature(37)1971..1973
Misc Feature(38)1971..1973
Misc Feature(39)1971..1973
Misc Feature(40)1971..1973
Misc Feature(41)1971..1973
Misc Feature(42)1974..1976
Misc Feature(43)1974..1976
Exon (1)1..475
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (2)476..600
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (3)601..729
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (4)730..841
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (5)842..989
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (6)990..1121
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (7)1122..1187
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (8)1188..1256
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (9)1257..1382
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (10)1383..1511
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (11)1512..1726
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (12)1727..1814
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (13)1815..1917
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Exon (14)1918..2989
Gene:AKT1
Gene Synonym:AKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Translation MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(9)-dbSNP:
complement(9)-t, cdbSNP:112005795
complement(41)-t, gdbSNP:182741149
47+c, tdbSNP:138573028
205+g, tdbSNP:1130214
complement(233)-t, cdbSNP:10138227
complement(311)-t, cdbSNP:190916256
complement(362)-t, cdbSNP:187239247
389+a, gdbSNP:147187121
complement(490)-dbSNP:
complement(490)-t, gdbSNP:371297714
complement(493)-t, cdbSNP:11555428
complement(507)-t, cdbSNP:370260488
509+a, gdbSNP:34790457
510+c, gdbSNP:34757714
complement(524)-g, cdbSNP:373561553
complement(525)-g, adbSNP:369911858
complement(526)-t, cdbSNP:181751951
547+c, tdbSNP:28730786
complement(548)-t, cdbSNP:113993465
complement(560)-g, adbSNP:371534192
complement(561)-t, cdbSNP:140532443
complement(563)-g, adbSNP:56217512
complement(598)-t, cdbSNP:368797346
603+dbSNP:
603+a, gdbSNP:121434592
complement(603)-, cdbSNP:34409589
627+c, tdbSNP:397514644
complement(650)-c, adbSNP:201636005
complement(674)-t, cdbSNP:370287382
complement(680)-t, cdbSNP:375645311
681+c, tdbSNP:11555436
complement(692)-t, gdbSNP:146875699
complement(696)-g, adbSNP:374093099
complement(760)-dbSNP:
complement(760)-t, cdbSNP:183989506
complement(821)-g, adbSNP:142646145
complement(899)-dbSNP:
complement(899)-t, cdbSNP:147664316
complement(915)-g, adbSNP:369198922
complement(981)-g, adbSNP:142843688
complement(984)-g, adbSNP:375990114
986+c, tdbSNP:17846825
complement(992)-dbSNP:
complement(992)-g, c, adbSNP:145780379
complement(1011)-g, adbSNP:149803079
complement(1037)-g, adbSNP:139904675
1054+c, tdbSNP:11555433
complement(1112)-g, adbSNP:34670300
complement(1116)-t, cdbSNP:144128670
complement(1133)-dbSNP:
complement(1133)-g, cdbSNP:139453090
1154+c, tdbSNP:61761191
1158+c, tdbSNP:2230506
complement(1169)-g, adbSNP:368770666
complement(1214)-dbSNP:
complement(1214)-g, adbSNP:141168205
complement(1219)-t, cdbSNP:369698909
complement(1223)-g, cdbSNP:376531915
complement(1250)-t, cdbSNP:201006619
complement(1253)-g, adbSNP:371786809
1280+dbSNP:
1280+a, gdbSNP:1130233
complement(1292)-g, adbSNP:368667384
complement(1317)-t, cdbSNP:375395037
complement(1337)-t, cdbSNP:143933508
complement(1340)-g, cdbSNP:371467719
complement(1352)-t, cdbSNP:367635775
complement(1361)-g, adbSNP:201044857
1364+a, gdbSNP:2230508
complement(1409)-g, adbSNP:149484260
complement(1433)-g, adbSNP:139200289
complement(1439)-t, cdbSNP:373838774
complement(1484)-g, adbSNP:146847196
complement(1505)-c, adbSNP:17846831
complement(1510)-t, cdbSNP:12881616
complement(1532)-dbSNP:
complement(1532)-g, adbSNP:55874341
complement(1574)-g, adbSNP:144088506
complement(1586)-g, adbSNP:56289559
complement(1607)-g, adbSNP:376942361
1624+c, tdbSNP:11555432
complement(1641)-t, cdbSNP:372502847
complement(1654)-t, cdbSNP:369520527
complement(1661)-t, cdbSNP:150399268
complement(1676)-g, adbSNP:374865919
complement(1677)-t, cdbSNP:373253729
complement(1688)-g, adbSNP:369527283
1716+a, cdbSNP:11555431
1733+dbSNP:
1733+c, tdbSNP:11555434
complement(1748)-g, adbSNP:151254374
complement(1749)-t, cdbSNP:188580689
complement(1771)-t, cdbSNP:143266084
complement(1781)-g, adbSNP:141303557
complement(1782)-t, cdbSNP:146483593
complement(1787)-g, adbSNP:375901448
complement(1805)-g, adbSNP:139297659
complement(1823)-dbSNP:
complement(1823)-t, cdbSNP:201227909
1857+a, cdbSNP:397514645
complement(1883)-t, cdbSNP:376893212
complement(1934)-dbSNP:
complement(1934)-g, adbSNP:139394285
1935+g, tdbSNP:11555435
complement(1943)-g, adbSNP:144112075
complement(1948)-t, cdbSNP:113547523
complement(1970)-g, adbSNP:184263655
complement(1985)-g, adbSNP:200213561
complement(1990)-g, adbSNP:201291259
complement(2003)-g, adbSNP:200508405
complement(2004)-t, cdbSNP:192237287
complement(2005)-c, adbSNP:111793056
complement(2013)-g, adbSNP:377339529
complement(2014)-t, cdbSNP:373329736
complement(2020)-g, adbSNP:375585585
complement(2021)-g, cdbSNP:370987171
complement(2044)-g, adbSNP:368920620
2046+a, gdbSNP:11555430
complement(2107)-t, cdbSNP:17846821
2118+c, tdbSNP:17846826
complement(2167)-t, cdbSNP:373002859
complement(2227)-t, g, adbSNP:112281303
2246+c, gdbSNP:61761249
2265+c, tdbSNP:34558581
complement(2298)-g, adbSNP:41307094
2320+a, c, gdbSNP:1130245
complement(2326)-t, cdbSNP:137981458
2365+a, cdbSNP:34865723
complement(2376)-t, adbSNP:113613978
2388+g, tdbSNP:35416681
2542+g, tdbSNP:1804268
2551+c, tdbSNP:1130295
complement(2701)-t, cdbSNP:386518033
2701+c, tdbSNP:1130443
complement(2761)-g, adbSNP:112114610
complement(2767..2768)-, cgaaaaggtcaagtdbSNP:55707948
2783..2784+, ttgaccttttcgac, ttgacctttttgacdbSNP:3840005
complement(2784)-t, cdbSNP:186886987
2815+c, tdbSNP:3803305
2850+c, tdbSNP:17846828
complement(2851)-g, cdbSNP:58565216
2857+a, gdbSNP:17846829
complement(2871)-g, adbSNP:183360200
complement(2877)-g, adbSNP:17102385
complement(2884)-t, cdbSNP:140320743
complement(2888)-g, adbSNP:190605178
complement(2893)-g, adbSNP:11555429
2966+c, tdbSNP:1130526
Gene SymbolAKT1
Gene SynonymAKT; CWS6; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Chromosome14
Locus Map14q32.32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001014432 Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2, mRNA. In-stock $509.00 $460.00 12
NM_005163 Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA. In-stock $509.00 $460.00 12
NM_001014431 Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 3, mRNA. In-stock $509.00 $460.00 12
XM_005267401 PREDICTED: Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant X1, mRNA. On-demand $699.00 18
Title Phosphoproteomics screen reveals akt isoform-specific signals linking RNA processing to lung cancer .
Author Sanidas I, Polytarchou C, Hatziapostolou M, Ezell SA, Kottakis F, Hu L, Guo A, Xie J, Comb MJ, Iliopoulos D and Tsichlis PN.
Journal Mol. Cell 53 (4), 577-590 (2014)
Title Akt is essential to induce NADPH-dependent NETosis and to switch the neutrophil death to apoptosis .
Author Douda DN, Yip L, Khan MA, Grasemann H and Palaniyar N.
Journal Blood 123 (4), 597-600 (2014)
Title Prognostic significance of protein kinase B/Akt pathway in patients with non-small cell lung cancer .
Author Mayadagli A, Karabulut Gul S, Bilici A, Fatih Oruc A, Kocak M, Ozkan A, Aksu A, Ozdemir Barisik N and Gumus M.
Journal J BUON 19 (1), 157-163 (2014)
Title Novel transcripts from a distinct promoter that encode the full-length AKT1 in human breast cancer cells .
Author Schmidt JW, Wehde BL, Sakamoto K, Triplett AA, West WW and Wagner KU.
Journal BMC Cancer 14, 195 (2014)
Title Effects of DNAzymes and siRNA targeting AKT1 on the growth of human .
Author Zhang M, Zhao H, Shi XZ, Wu J, Fu Q and Shi W.
Journal Clin. Lab. 60 (1), 1-8 (2014)
Title Proteus Syndrome .
Author Biesecker,L.G. and Sapp,J.C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families .
Author Coffer,P.J. and Woodgett,J.R.
Journal Eur. J. Biochem. 205 (3), 1217 (1992)
Title Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families .
Author Coffer PJ and Woodgett JR.
Journal Eur. J. Biochem. 201 (2), 475-481 (1991)
Title Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily .
Author Jones PF, Jakubowicz T, Pitossi FJ, Maurer F and Hemmings BA.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (10), 4171-4175 (1991)
Title Molecular cloning of the akt oncogene and its human homologues AKT1 and AKT2: amplification of AKT1 in a primary human gastric adenocarcinoma .
Author Staal,S.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 84 (14), 5034-5037 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.