Sequence in raw or FASTA format:

Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA.

Summary
Sequence
Translation
SNP
Other Variants
PubMed

RefSeq Version	NM_005163.2, 62241010
Length	3008 bp
Structure	linear
Update Date	30-APR-2011
Organism	Homo sapiens (human)
Definition	Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA.
Product	RAC-alpha serine/threonine-protein kinase
Comment	Summary: The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) is the longest transcript. Variants 1, 2 and 3 encode the same protein.

RefSeq	NP_005154.2
CDS	555..1997
Exon (1)	1..475
Exon (2)	1..475
Exon (3)	476..600
Exon (4)	601..729
Exon (5)	730..841
Exon (6)	842..989
Exon (7)	990..1121
Exon (8)	1122..1187
Exon (9)	1188..1256
Exon (10)	1257..1382
Exon (11)	1383..1511
Exon (12)	1512..1726
Exon (13)	1727..1814
Exon (14)	1815..1917
Exon (15)	1918..2989
Translation	MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.

Position	Chain	Variation	Link
complement(9)	-	t, c	dbSNP:112005795
205	+	g, t	dbSNP:1130214
complement(233)	-	t, c	dbSNP:10138227
complement(493)	-	t, c	dbSNP:11555428
509	+	a, g	dbSNP:34790457
510	+	c, g	dbSNP:34757714
547	+	c, t	dbSNP:28730786
complement(548)	-	t, c	dbSNP:113993465
complement(563)	-	g, a	dbSNP:56217512
603	+	a, g	dbSNP:121434592
complement(603)	-	, c	dbSNP:34409589
681	+	c, t	dbSNP:11555436
complement(764)	-	, g	dbSNP:67887424
986	+	c, t	dbSNP:17846825
complement(989)	-	, largedeletion	dbSNP:71680135
complement(1032..1033)	-	, a	dbSNP:72256887
1054	+	c, t	dbSNP:11555433
complement(1112)	-	g, a	dbSNP:34670300
1154	+	c, t	dbSNP:61761191
1158	+	c, t	dbSNP:2230506
complement(1220..1221)	-	, g	dbSNP:67119047
1280	+	a, g	dbSNP:1130233
1364	+	a, g	dbSNP:2230508
1505	+	a, c	dbSNP:17846831
complement(1510)	-	t, c	dbSNP:12881616
complement(1532)	-	g, a	dbSNP:55874341
complement(1586)	-	g, a	dbSNP:56289559
1624	+	c, t	dbSNP:11555432
1716	+	a, c	dbSNP:11555431
1733	+	c, t	dbSNP:11555434
complement(1886..1887)	-	, g	dbSNP:67335435
1935	+	g, t	dbSNP:11555435
complement(1948)	-	t, c	dbSNP:113547523
complement(2005)	-	c, a	dbSNP:111793056
2046	+	a, g	dbSNP:11555430
2107	+	c, t	dbSNP:17846821
2118	+	c, t	dbSNP:17846826
complement(2227)	-	t, a	dbSNP:112281303
2246	+	c, g	dbSNP:61761249
2265	+	c, t	dbSNP:34558581
complement(2298)	-	g, a	dbSNP:41307094
2320	+	c, g	dbSNP:1130245
2365	+	a, c	dbSNP:34865723
complement(2376)	-	t, a	dbSNP:113613978
2388	+	g, t	dbSNP:35416681
complement(2524..2525)	-	, ag	dbSNP:71866612
2542	+	g, t	dbSNP:1804268
2551	+	c, t	dbSNP:1130295
2701	+	c, t	dbSNP:1130443
complement(2761)	-	g, a	dbSNP:112114610
complement(2767..2768)	-	, cgaaaaggtcaagt	dbSNP:55707948
2783..2784	+	, ttgacctttttgac	dbSNP:3840005
2815	+	c, t	dbSNP:3803305
2850	+	c, t	dbSNP:17846828
complement(2851)	-	g, c	dbSNP:58565216
2857	+	a, g	dbSNP:17846829
complement(2877)	-	g, a	dbSNP:17102385
complement(2893)	-	g, a	dbSNP:11555429
2966	+	c, t	dbSNP:1130526

Gene Symbol	AKT1
Gene Synonym	AKT; MGC99656; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Chromosome	14
Locus Map	14q32.32
All Transcripts	NM_005163 , NM_001014431 , NM_001014432

Title	Herpes simplex virus requires VP11/12 to activate Src family kinase-phosphoinositide 3-kinase-Akt signaling .
Author	Wagner,M.J. and Smiley,J.R.
Journal	J. Virol. 85 (6), 2803-2812 (2011)
Title	Akt directly regulates focal adhesion kinase through association and serine phosphorylation: implication for pressure-induced colon cancer metastasis .
Author	Wang,S. and Basson,M.D.
Journal	Am. J. Physiol., Cell Physiol. 300 (3), C657-C670 (2011)
Title	Resveratrol enhances the anti-tumor activity of the mTOR inhibitor rapamycin in multiple breast cancer cell lines mainly by suppressing rapamycin-induced AKT signaling .
Author	He,X., Wang,Y., Zhu,J., Orloff,M. and Eng,C.
Journal	Cancer Lett. 301 (2), 168-176 (2011)
Title	Akt requires glucose metabolism to suppress puma expression and prevent apoptosis of leukemic T cells .
Author	Coloff,J.L., Mason,E.F., Altman,B.J., Gerriets,V.A., Liu,T., Nichols,A.N., Zhao,Y., Wofford,J.A., Jacobs,S.R., Ilkayeva,O., Garrison,S.P., Zambetti,G.P. and Rathmell,J.C.
Journal	J. Biol. Chem. 286 (7), 5921-5933 (2011)
Title	p28GANK overexpression accelerates hepatocellular carcinoma invasiveness and metastasis via phosphoinositol 3-kinase/AKT/hypoxia-inducible factor-1alpha pathways .
Author	Fu,J., Chen,Y., Cao,J., Luo,T., Qian,Y.W., Yang,W., Ren,Y.B., Su,B., Cao,G.W., Yang,Y., Yan,Y.Q., Shen,F., Wu,M.C., Feng,G.S. and Wang,H.Y.
Journal	Hepatology 53 (1), 181-192 (2011)
Title	Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families .
Author	Coffer,P.J. and Woodgett,J.R.
Journal	Eur. J. Biochem. 205 (3), 1217 (1992)
Title	Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families .
Author	Coffer,P.J. and Woodgett,J.R.
Journal	Eur. J. Biochem. 201 (2), 475-481 (1991)
Title	Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily .
Author	Jones,P.F., Jakubowicz,T., Pitossi,F.J., Maurer,F. and Hemmings,B.A.
Journal	Proc. Natl. Acad. Sci. U.S.A. 88 (10), 4171-4175 (1991)
Title	The AKT1 proto-oncogene maps to human chromosome 14, band q32 .
Author	Staal,S.P., Huebner,K., Croce,C.M., Parsa,N.Z. and Testa,J.R.
Journal	Genomics 2 (1), 96-98 (1988)
Title	Molecular cloning of the akt oncogene and its human homologues AKT1 and AKT2: amplification of AKT1 in a primary human gastric adenocarcinoma .
Author	Staal,S.P.
Journal	Proc. Natl. Acad. Sci. U.S.A. 84 (14), 5034-5037 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

	Secured Online Quotation
	Email: gene@genscript.com
	Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
	Fax: 1-732-210-0262 1-732-885-5878

RefSeq Accession	Definition	Sequence	Price	Select
NM_005163	Homo sapiens v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, mRNA.	Full Lenth	$1052.80
NM_005163		ORF Sequence	$418.47