• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens choline kinase beta (CHKB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005198 Homo sapiens choline kinase beta (CHKB), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_005198.4, 242246959
Length 1648 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens choline kinase beta (CHKB), mRNA.
Product choline/ethanolamine kinase
Comment

Summary: Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq, Jun 2009].

RefSeq NP_005189.2
CDS 219..1406
Misc Feature(1)105..107
Misc Feature(2)105..107
Misc Feature(3)222..224
Misc Feature(4)222..224
Misc Feature(5)387..1382
Misc Feature(6)423..1298
Misc Feature(7)order(441..443,447..449,453..458,462..464,522..524,
Misc Feature(8)order(441..443,456..458,462..464,522..524,528..530,
Misc Feature(9)order(447..449,453..455,942..944,948..950,957..959,
Misc Feature(10)447..455
Misc Feature(11)order(567..569,576..581,588..593,600..605,621..632,
Exon (1)1..442
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (2)443..551
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (3)552..665
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (4)666..799
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (5)800..895
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (6)896..954
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (7)955..1036
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (8)1037..1145
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (9)1146..1249
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (10)1250..1331
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Exon (11)1332..1629
Gene:CHKB
Gene Synonym:CHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Translation MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(122)-g, cdbSNP:114094125
complement(139)-, ttccttccggccgcgctcggdbSNP:57453364
complement(145..164)-, gctcggttccttccggccgcdbSNP:144647670
complement(171)-c, adbSNP:41282357
complement(232)-g, adbSNP:199703765
complement(298)-t, adbSNP:149592688
complement(367)-t, cdbSNP:138205828
complement(402)-g, adbSNP:147043849
complement(414)-t, gdbSNP:141533752
complement(434)-g, adbSNP:80067609
complement(454)-dbSNP:
complement(454)-t, cdbSNP:13054973
complement(467)-g, adbSNP:180979987
complement(481)-g, adbSNP:146163970
complement(493)-g, adbSNP:140867913
complement(552)-dbSNP:
complement(552)-g, cdbSNP:150987240
complement(564)-g, adbSNP:189564179
complement(572)-t, cdbSNP:142607228
complement(646)-g, cdbSNP:201257544
complement(669)-dbSNP:
complement(669)-g, adbSNP:148857303
complement(670)-t, cdbSNP:184839240
complement(675)-g, adbSNP:146693439
complement(719)-c, adbSNP:199704510
complement(734)-t, cdbSNP:200220080
complement(787)-t, cdbSNP:143210467
complement(791)-t, gdbSNP:201476966
complement(799)-t, cdbSNP:139818555
complement(815)-dbSNP:
complement(815)-g, adbSNP:146409721
complement(888)-t, gdbSNP:149858290
complement(910)-dbSNP:
complement(910)-g, cdbSNP:199783402
complement(920)-t, cdbSNP:139952595
complement(922)-g, cdbSNP:199847760
complement(923)-t, gdbSNP:150676350
complement(926)-g, adbSNP:141934594
complement(927)-t, cdbSNP:184254424
complement(1021)-dbSNP:
complement(1021)-t, cdbSNP:201148042
complement(1032)-g, adbSNP:202048376
complement(1088)-dbSNP:
complement(1088)-t, gdbSNP:140020889
complement(1120)-g, adbSNP:147485527
complement(1126)-t, cdbSNP:143061031
complement(1143)-g, cdbSNP:139059552
complement(1158)-dbSNP:
complement(1158)-g, adbSNP:200919604
complement(1162)-t, cdbSNP:199641367
complement(1179)-t, cdbSNP:143218928
complement(1201)-t, cdbSNP:141381896
complement(1248)-g, adbSNP:138074497
complement(1297)-dbSNP:
complement(1297)-t, cdbSNP:150361827
complement(1375)-dbSNP:
complement(1375)-t, cdbSNP:140289037
complement(1502)-g, cdbSNP:17001634
complement(1524)-g, adbSNP:9616871
complement(1532)-g, c, adbSNP:112742765
complement(1540)-t, g, c, adbSNP:1056964
complement(1577)-g, adbSNP:1056971
complement(1600)-c, adbSNP:1135081
complement(1614)-c, adbSNP:41281533
complement(1622)-g, cdbSNP:3180872
complement(1623)-c, adbSNP:3180873
Gene SymbolCHKB
Gene SynonymCHETK; CHKL; CK; CKB; CKEKB; EK; EKB; MDCMC
Chromosome22
Locus Map22q13.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005198 Homo sapiens choline kinase beta (CHKB), mRNA. In-stock $418.00 $369.00 10
Title TCRA, P2RY11, and CPT1B/CHKB associations in Chinese narcolepsy .
Author Han,F., Lin,L., Li,J., Aran,A., Dong,S.X., An,P., Zhao,L., Li,Q.Y., Yan,H., Wang,J.S., Gao,H.Y., Li,M., Gao,Z.C., Strohl,K.P. and Mignot,E.
Journal Sleep Med. 13 (3), 269-272 (2012)
Title A congenital muscular dystrophy with mitochondrial structural abnormalities caused by defective de novo phosphatidylcholine biosynthesis .
Author Mitsuhashi,S., Ohkuma,A., Talim,B., Karahashi,M., Koumura,T., Aoyama,C., Kurihara,M., Quinlivan,R., Sewry,C., Mitsuhashi,H., Goto,K., Koksal,B., Kale,G., Ikeda,K., Taguchi,R., Noguchi,S., Hayashi,Y.K., Nonaka,I., Sher,R.B., Sugimoto,H., Nakagawa,Y., Cox,G.A., Topaloglu,H. and Nishino,I.
Journal Am. J. Hum. Genet. 88 (6), 845-851 (2011)
Title Choline kinase and its function .
Author Wu,G. and Vance,D.E.
Journal Biochem. Cell Biol. 88 (4), 559-564 (2010)
Title Crystal structures of human choline kinase isoforms in complex with hemicholinium-3: single amino acid near the active site influences inhibitor sensitivity .
Author Hong,B.S., Allali-Hassani,A., Tempel,W., Finerty,P.J. Jr., Mackenzie,F., Dimov,S., Vedadi,M. and Park,H.W.
Journal J. Biol. Chem. 285 (21), 16330-16340 (2010)
Title Distinct choline metabolic profiles are associated with differences in gene expression for basal-like and luminal-like breast cancer xenograft models .
Author Moestue,S.A., Borgan,E., Huuse,E.M., Lindholm,E.M., Sitter,B., Borresen-Dale,A.L., Engebraaten,O., Maelandsmo,G.M. and Gribbestad,I.S.
Journal BMC Cancer 10, 433 (2010)
Title Variant between CPT1B and CHKB associated with susceptibility to narcolepsy .
Author Miyagawa,T., Kawashima,M., Nishida,N., Ohashi,J., Kimura,R., Fujimoto,A., Shimada,M., Morishita,S., Shigeta,T., Lin,L., Hong,S.C., Faraco,J., Shin,Y.K., Jeong,J.H., Okazaki,Y., Tsuji,S., Honda,M., Honda,Y., Mignot,E. and Tokunaga,K.
Journal Nat. Genet. 40 (11), 1324-1328 (2008)
Title Structure and function of choline kinase isoforms in mammalian cells .
Author Aoyama,C., Liao,H. and Ishidate,K.
Journal Prog. Lipid Res. 43 (3), 266-281 (2004)
Title Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping .
Author Hirosawa,M., Nagase,T., Murahashi,Y., Kikuno,R. and Ohara,O.
Journal DNA Res. 8 (1), 1-9 (2001)
Title Novel expression of equivocal messages containing both regions of choline/ethanolamine kinase and muscle type carnitine palmitoyltransferase I .
Author Yamazaki,N., Shinohara,Y., Kajimoto,K., Shindo,M. and Terada,H.
Journal J. Biol. Chem. 275 (41), 31739-31746 (2000)
Title Choline/ethanolamine kinase from mammalian tissues .
Author Ishidate,K.
Journal Biochim. Biophys. Acta 1348 (1-2), 70-78 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.