• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens colony stimulating factor 1 receptor (CSF1R), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005211 Homo sapiens colony stimulating factor 1 receptor (CSF1R), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_005211.3, 195947380
Length 4006 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens colony stimulating factor 1 receptor (CSF1R), mRNA.
Product macrophage colony-stimulating factor 1 receptor precursor
Comment

Summary: The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. [provided by RefSeq, Jul 2008].

RefSeq NP_005202.2
CDS 293..3211
Misc Feature(1)41..43
Misc Feature(2)374..547
Misc Feature(3)950..1165
Misc Feature(4)1187..1492
Misc Feature(5)order(1397..1408,1415..1417)
Misc Feature(6)1538..1777
Misc Feature(7)1844..1906
Misc Feature(8)1916..2014
Misc Feature(9)1919..3034
Misc Feature(10)1928..1930
Misc Feature(11)1973..1975
Misc Feature(12)order(2054..2059,2063..2074,2078..2080,2132..2134,
Misc Feature(13)order(2054..2059,2063..2074,2078..2080,2132..2134,
Misc Feature(14)2387..2389
Misc Feature(15)2414..2416
Misc Feature(16)2429..2431
Misc Feature(17)2459..2461
Misc Feature(18)2459..2461
Misc Feature(19)<2513..3022
Misc Feature(20)order(2624..2626,2636..2638,2732..2746,2771..2773,
Misc Feature(21)2675..2752
Misc Feature(22)2678..2746
Misc Feature(23)2717..2719
Misc Feature(24)2717..2719
Misc Feature(25)3059..3061
Misc Feature(26)3197..3199
Exon (1)1..112
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (2)113..341
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (3)342..599
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (4)600..884
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (5)885..1021
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (6)1022..1181
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (7)1182..1374
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (8)1375..1490
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (9)1491..1611
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (10)1612..1802
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (11)1803..1918
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (12)1919..2045
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (13)2046..2150
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (14)2151..2261
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (15)2262..2424
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (16)2425..2513
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (17)2514..2611
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (18)2612..2734
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (19)2735..2846
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (20)2847..2946
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (21)2947..3055
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (22)3056..3989
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Translation MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA QPLLQPNNYQFC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-dbSNP:
complement(26)-t, gdbSNP:149787411
complement(39)-t, cdbSNP:192603944
complement(44)-t, cdbSNP:180988739
complement(81..86)-, ctcttcdbSNP:71952049
complement(83)-, ttcctcdbSNP:71864983
complement(86)-, ctcttcdbSNP:60338145
complement(106)-t, cdbSNP:11740408
complement(160)-c, adbSNP:200099266
complement(256)-t, gdbSNP:200530219
complement(376)-dbSNP:
complement(376)-g, adbSNP:216123
complement(377)-t, cdbSNP:148727692
complement(385)-t, c, adbSNP:41424646
complement(387)-c, adbSNP:56048668
complement(402)-g, adbSNP:139635308
complement(422)-t, cdbSNP:147408195
complement(447)-c, adbSNP:144261133
complement(454)-t, cdbSNP:139516059
complement(470)-g, adbSNP:55865465
complement(478)-g, adbSNP:150547844
complement(479)-g, cdbSNP:141621829
complement(484)-g, adbSNP:56282370
complement(492)-t, cdbSNP:147989288
complement(493)-g, adbSNP:200054887
complement(529)-t, cdbSNP:146145627
complement(559)-g, adbSNP:143080503
complement(560)-t, gdbSNP:150475750
complement(574)-g, adbSNP:41287102
complement(586)-g, adbSNP:17652007
complement(606)-dbSNP:
complement(606)-g, adbSNP:138794488
complement(608)-g, adbSNP:143025739
complement(610)-t, cdbSNP:111792217
complement(660)-g, cdbSNP:140924076
complement(661)-t, gdbSNP:147673106
complement(667)-t, cdbSNP:145276897
complement(709)-t, cdbSNP:61753457
complement(716)-g, adbSNP:147811334
complement(749)-t, gdbSNP:144404275
complement(762)-g, adbSNP:148673905
complement(843)-g, cdbSNP:143941779
complement(902)-dbSNP:
complement(902)-g, cdbSNP:201523105
complement(977)-t, cdbSNP:149911279
complement(1003)-g, adbSNP:139003947
complement(1013)-t, cdbSNP:79702016
complement(1018)-t, cdbSNP:2228422
complement(1025)-dbSNP:
complement(1025)-t, gdbSNP:41338945
complement(1032)-t, gdbSNP:17855673
complement(1051)-g, adbSNP:186867171
complement(1056)-t, adbSNP:146406037
complement(1059)-t, cdbSNP:200702302
complement(1082)-t, gdbSNP:141512698
complement(1088)-t, cdbSNP:148357861
complement(1094)-t, cdbSNP:143274491
complement(1127)-g, adbSNP:3829986
complement(1173)-t, cdbSNP:149168939
complement(1194)-dbSNP:
complement(1194)-t, c, adbSNP:121913390
complement(1237)-g, cdbSNP:201393400
complement(1312)-t, adbSNP:200702893
complement(1325)-g, cdbSNP:138251519
complement(1346)-c, adbSNP:147036327
complement(1353)-g, adbSNP:17854479
complement(1377)-dbSNP:
complement(1377)-t, cdbSNP:10079250
complement(1429)-g, adbSNP:201361036
complement(1435)-g, cdbSNP:183264626
complement(1529)-dbSNP:
complement(1529)-t, cdbSNP:34951517
complement(1533)-g, adbSNP:149753251
complement(1575)-t, cdbSNP:140815605
complement(1609)-g, adbSNP:150988615
complement(1693)-dbSNP:
complement(1693)-t, cdbSNP:200733774
complement(1696)-t, cdbSNP:201654254
complement(1712)-t, cdbSNP:191994354
complement(1807)-dbSNP:
complement(1807)-g, adbSNP:141577445
complement(1809)-t, gdbSNP:142543645
complement(1820)-g, cdbSNP:139203165
complement(1822..1823)-, cdbSNP:145267004
complement(1839)-g, adbSNP:201012043
complement(1844)-t, cdbSNP:138432536
complement(1895)-g, adbSNP:143156748
complement(1898)-g, cdbSNP:55942044
complement(1945)-dbSNP:
complement(1945)-t, cdbSNP:201104874
complement(1984)-g, adbSNP:139830484
complement(1992)-t, cdbSNP:41529644
complement(2029)-g, cdbSNP:200147916
complement(2052)-dbSNP:
complement(2052)-g, adbSNP:146386843
complement(2056)-g, adbSNP:149436601
complement(2058)-g, adbSNP:281860268
complement(2091)-g, adbSNP:200788902
complement(2122)-t, gdbSNP:200536087
complement(2164)-dbSNP:
complement(2164)-c, adbSNP:139845496
complement(2177)-c, adbSNP:17854478
complement(2189)-g, adbSNP:281860269
complement(2221)-g, adbSNP:184499252
complement(2280)-dbSNP:
complement(2280)-g, adbSNP:200489778
complement(2343)-t, cdbSNP:150668652
complement(2360)-t, cdbSNP:141866247
complement(2374)-t, cdbSNP:56316417
complement(2399)-g, adbSNP:111943087
complement(2404)-g, adbSNP:147072380
complement(2407)-t, cdbSNP:3733670
complement(2421)-t, cdbSNP:201569135
complement(2459)-dbSNP:
complement(2459)-g, adbSNP:142978503
complement(2477)-t, cdbSNP:139061724
complement(2500)-g, adbSNP:143167751
complement(2509)-g, cdbSNP:199915312
complement(2531)-dbSNP:
complement(2531)-g, adbSNP:41355444
complement(2536)-g, cdbSNP:144976075
complement(2547)-c, adbSNP:150349257
complement(2589)-t, cdbSNP:281860270
complement(2599)-g, adbSNP:199640967
complement(2600)-g, cdbSNP:281860271
complement(2616)-dbSNP:
complement(2616)-t, adbSNP:281860273
complement(2635)-t, cdbSNP:55804445
complement(2637)-g, adbSNP:281860281
complement(2647)-t, cdbSNP:140363958
complement(2673)-t, cdbSNP:281860274
complement(2791)-dbSNP:
complement(2791)-t, cdbSNP:149872699
complement(2800)-g, adbSNP:146691087
complement(2824)-g, adbSNP:55657214
complement(2827)-g, cdbSNP:56327604
complement(2834)-t, cdbSNP:200284956
complement(2838..2840)-, tctdbSNP:281860276
complement(2838)-t, cdbSNP:281860277
complement(2891)-dbSNP:
complement(2891)-t, gdbSNP:139797829
complement(2895)-t, cdbSNP:281860278
complement(2916)-t, cdbSNP:281860279
complement(2924)-c, adbSNP:281860280
complement(3001)-dbSNP:
complement(3001)-g, adbSNP:41287094
complement(3028)-t, cdbSNP:201061537
complement(3038)-t, cdbSNP:142435467
complement(3050)-t, cdbSNP:200925061
complement(3052)-g, cdbSNP:34030164
complement(3053)-g, adbSNP:202216061
complement(3054)-t, cdbSNP:56059682
complement(3072)-dbSNP:
complement(3072)-g, adbSNP:144414073
complement(3091)-g, adbSNP:41287092
complement(3095)-t, cdbSNP:140118369
complement(3097)-g, adbSNP:147476583
complement(3133)-g, adbSNP:148054244
complement(3154)-g, adbSNP:56005231
complement(3155)-t, cdbSNP:200068110
complement(3197)-t, cdbSNP:121913393
complement(3198)-t, g, adbSNP:1801271
complement(3199)-t, adbSNP:121913392
complement(3246..3247)-tg, gadbSNP:35308019
complement(3246)-t, cdbSNP:2066933
complement(3247)-c, adbSNP:2066934
complement(3275)-g, adbSNP:144642625
complement(3293)-g, adbSNP:191000580
complement(3306)-g, adbSNP:142730720
complement(3327)-g, adbSNP:188032016
complement(3410)-t, cdbSNP:138239430
complement(3441..3442)-, cdbSNP:66970099
complement(3442..3443)-, gdbSNP:3216780
complement(3442)-g, cdbSNP:78449650
complement(3443..3444)-, gcdbSNP:199650587
complement(3443)-, cggdbSNP:72543477
complement(3444..3445)-, gdbSNP:200927456
complement(3445)-g, adbSNP:114947856
complement(3521)-c, adbSNP:41497048
complement(3547)-g, adbSNP:182193643
complement(3616)-g, cdbSNP:1058920
complement(3617)-t, adbSNP:11546510
complement(3637)-g, cdbSNP:140616824
complement(3711)-g, adbSNP:138905856
complement(3723)-t, cdbSNP:13117
complement(3739)-g, adbSNP:189742476
complement(3798)-g, cdbSNP:9727
complement(3815)-t, cdbSNP:150244467
complement(3846)-t, cdbSNP:1058950
complement(3943)-c, adbSNP:12500
complement(3980)-t, cdbSNP:3828609
Gene SymbolCSF1R
Gene SynonymC-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Chromosome5
Locus Map5q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005211 Homo sapiens colony stimulating factor 1 receptor (CSF1R), mRNA. On-demand $899.00 20
Title Regulation of microglial proliferation during chronic neurodegeneration .
Author Gomez-Nicola,D., Fransen,N.L., Suzzi,S. and Perry,V.H.
Journal J. Neurosci. 33 (6), 2481-2493 (2013)
Title Gene expression profiling of microdissected Hodgkin Reed-Sternberg cells correlates with treatment outcome in classical Hodgkin lymphoma .
Author Steidl,C., Diepstra,A., Lee,T., Chan,F.C., Farinha,P., Tan,K., Telenius,A., Barclay,L., Shah,S.P., Connors,J.M., van den Berg,A. and Gascoyne,R.D.
Journal Blood 120 (17), 3530-3540 (2012)
Title Increased expression of macrophage colony-stimulating factor and its receptor in patients with endometriosis .
Author Budrys,N.M., Nair,H.B., Liu,Y.G., Kirma,N.B., Binkley,P.A., Kumar,S., Schenken,R.S. and Tekmal,R.R.
Journal Fertil. Steril. 97 (5), 1129-1135 (2012)
Title Macrophage proliferation is regulated through CSF-1 receptor tyrosines 544, 559, and 807 .
Author Yu,W., Chen,J., Xiong,Y., Pixley,F.J., Yeung,Y.G. and Stanley,E.R.
Journal J. Biol. Chem. 287 (17), 13694-13704 (2012)
Title Mutations in the colony stimulating factor 1 receptor (CSF1R) gene cause hereditary diffuse leukoencephalopathy with spheroids .
Author Rademakers,R., Baker,M., Nicholson,A.M., Rutherford,N.J., Finch,N., Soto-Ortolaza,A., Lash,J., Wider,C., Wojtas,A., DeJesus-Hernandez,M., Adamson,J., Kouri,N., Sundal,C., Shuster,E.A., Aasly,J., MacKenzie,J., Roeber,S., Kretzschmar,H.A., Boeve,B.F., Knopman,D.S., Petersen,R.C., Cairns,N.J., Ghetti,B., Spina,S., Garbern,J., Tselis,A.C., Uitti,R., Das,P., Van Gerpen,J.A., Meschia,J.F., Levy,S., Broderick,D.F., Graff-Radford,N., Ross,O.A., Miller,B.B., Swerdlow,R.H., Dickson,D.W. and Wszolek,Z.K.
Journal Nat. Genet. 44 (2), 200-205 (2012)
Title Expression and characterization of the p85 subunit of the phosphatidylinositol 3-kinase complex and a related p85 beta protein by using the baculovirus expression system .
Author Gout,I., Dhand,R., Panayotou,G., Fry,M.J., Hiles,I., Otsu,M. and Waterfield,M.D.
Journal Biochem. J. 288 (PT 2), 395-405 (1992)
Title Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23 .
Author Galland,F., Stefanova,M., Lafage,M. and Birnbaum,D.
Journal Cytogenet. Cell Genet. 60 (2), 114-116 (1992)
Title Myc rescue of a mutant CSF-1 receptor impaired in mitogenic signalling .
Author Roussel,M.F., Cleveland,J.L., Shurtleff,S.A. and Sherr,C.J.
Journal Nature 353 (6342), 361-363 (1991)
Title Interactions of phosphatidylinositol kinase, GTPase-activating protein (GAP), and GAP-associated proteins with the colony-stimulating factor 1 receptor .
Author Reedijk,M., Liu,X.Q. and Pawson,T.
Journal Mol. Cell. Biol. 10 (11), 5601-5608 (1990)
Title FMS mutations in myelodysplastic, leukemic, and normal subjects .
Author Ridge,S.A., Worwood,M., Oscier,D., Jacobs,A. and Padua,R.A.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (4), 1377-1380 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.