• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24034 Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu24034C Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005211.3, 195947380
Length 2919 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA.
Product macrophage colony-stimulating factor 1 receptor precursor
Comment

Summary: The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013].


Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 2 encode the same protein.

RefSeq NP_005202.2
CDS 293..3211
Misc Feature(1)41..43
Misc Feature(2)353..>547
Misc Feature(3)374..547
Misc Feature(4)917..1162
Misc Feature(5)950..1165
Misc Feature(6)1187..1492
Misc Feature(7)order(1397..1408,1415..1417)
Misc Feature(8)1493..1777
Misc Feature(9)1538..1777
Misc Feature(10)1844..1906
Misc Feature(11)1916..2014
Misc Feature(12)1919..3034
Misc Feature(13)1928..1930
Misc Feature(14)1973..1975
Misc Feature(15)2036..3022
Misc Feature(16)order(2054..2059,2063..2074,2078..2080,2132..2134,
Misc Feature(17)order(2054..2059,2063..2074,2078..2080,2132..2134,
Misc Feature(18)2387..2389
Misc Feature(19)2414..2416
Misc Feature(20)2429..2431
Misc Feature(21)2459..2461
Misc Feature(22)2459..2461
Misc Feature(23)order(2624..2626,2636..2638,2732..2746,2771..2773,
Misc Feature(24)2675..2752
Misc Feature(25)2678..2746
Misc Feature(26)2717..2719
Misc Feature(27)2717..2719
Misc Feature(28)3059..3061
Misc Feature(29)3197..3199
Exon (1)1..112
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (2)113..341
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (3)342..599
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (4)600..884
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (5)885..1021
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (6)1022..1181
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (7)1182..1374
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (8)1375..1490
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (9)1491..1611
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (10)1612..1802
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (11)1803..1918
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (12)1919..2045
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (13)2046..2150
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (14)2151..2261
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (15)2262..2424
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (16)2425..2513
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (17)2514..2611
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (18)2612..2734
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (19)2735..2846
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (20)2847..2946
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (21)2947..3055
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Exon (22)3056..3989
Gene:CSF1R
Gene Synonym:C-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Translation MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA QPLLQPNNYQFC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-dbSNP:
complement(26)-t, gdbSNP:149787411
complement(37)-t, cdbSNP:376592195
complement(39)-t, cdbSNP:192603944
complement(44)-t, cdbSNP:180988739
complement(81..86)-, ctcttcdbSNP:60338145
complement(106)-t, cdbSNP:11740408
complement(160)-c, adbSNP:200099266
complement(249)-g, adbSNP:368383472
complement(256)-t, gdbSNP:200530219
complement(268)-t, adbSNP:375640786
complement(278)-c, adbSNP:369258728
complement(286)-g, adbSNP:371283991
complement(376)-dbSNP:
complement(376)-g, adbSNP:216123
complement(377)-t, cdbSNP:148727692
complement(385)-t, c, adbSNP:41424646
complement(386)-t, cdbSNP:372210450
complement(387)-c, adbSNP:56048668
complement(402)-g, adbSNP:139635308
complement(422)-t, cdbSNP:147408195
complement(447)-c, adbSNP:144261133
complement(454)-t, cdbSNP:139516059
complement(470)-g, adbSNP:55865465
complement(478)-g, adbSNP:150547844
complement(479)-g, cdbSNP:141621829
complement(484)-g, adbSNP:56282370
complement(492)-t, cdbSNP:147989288
complement(493)-g, adbSNP:200054887
complement(529)-t, cdbSNP:146145627
complement(535)-g, adbSNP:370626621
complement(559)-g, adbSNP:143080503
complement(560)-t, gdbSNP:150475750
complement(574)-g, adbSNP:41287102
complement(586)-g, adbSNP:17652007
complement(606)-dbSNP:
complement(606)-g, adbSNP:138794488
complement(608)-g, adbSNP:143025739
complement(610)-t, cdbSNP:111792217
complement(640)-g, adbSNP:377162015
complement(660)-g, cdbSNP:140924076
complement(661)-t, gdbSNP:147673106
complement(667)-t, cdbSNP:145276897
complement(709)-t, cdbSNP:61753457
complement(716)-g, adbSNP:147811334
complement(740)-g, adbSNP:374166176
complement(749)-t, gdbSNP:144404275
complement(762)-g, adbSNP:148673905
complement(843)-g, cdbSNP:143941779
complement(899)-dbSNP:
complement(899)-g, adbSNP:370894971
complement(902)-g, cdbSNP:201523105
complement(933)-t, cdbSNP:376495524
complement(977)-t, cdbSNP:149911279
complement(1003)-g, adbSNP:139003947
complement(1013)-t, cdbSNP:79702016
complement(1018)-t, cdbSNP:386561691
1018+c, tdbSNP:2228422
complement(1025)-dbSNP:
complement(1025)-t, gdbSNP:41338945
complement(1032)-t, gdbSNP:17855673
complement(1051)-g, adbSNP:186867171
complement(1054)-g, adbSNP:374353325
complement(1056)-t, adbSNP:146406037
complement(1059)-t, cdbSNP:200702302
complement(1082)-t, gdbSNP:141512698
complement(1087)-g, adbSNP:377406801
complement(1088)-t, cdbSNP:148357861
complement(1094)-t, cdbSNP:143274491
complement(1111)-g, adbSNP:373141539
1127+a, gdbSNP:3829986
complement(1139)-t, cdbSNP:375148574
complement(1172)-g, adbSNP:371848144
complement(1173)-t, cdbSNP:149168939
complement(1187)-dbSNP:
complement(1187)-t, cdbSNP:370361925
1194+a, c, tdbSNP:121913390
complement(1219)-t, gdbSNP:375971167
complement(1237)-g, c, adbSNP:201393400
complement(1312)-t, adbSNP:200702893
complement(1325)-g, cdbSNP:138251519
complement(1353)-g, adbSNP:17854479
complement(1377)-dbSNP:
complement(1377)-t, cdbSNP:10079250
complement(1417)-t, cdbSNP:373828759
complement(1423)-g, adbSNP:369678672
complement(1429)-g, adbSNP:201361036
complement(1435)-g, cdbSNP:183264626
complement(1508)-dbSNP:
complement(1508)-t, cdbSNP:377213618
complement(1512)-g, adbSNP:372924085
complement(1529)-t, cdbSNP:34951517
complement(1533)-g, adbSNP:149753251
complement(1550)-c, adbSNP:377101581
complement(1575)-t, cdbSNP:140815605
complement(1594)-g, adbSNP:369184681
complement(1609)-g, adbSNP:150988615
complement(1692)-dbSNP:
complement(1692)-g, adbSNP:376388107
complement(1693)-t, cdbSNP:200733774
complement(1696)-t, cdbSNP:201654254
complement(1712)-t, cdbSNP:191994354
complement(1734)-t, cdbSNP:374872712
complement(1807)-dbSNP:
complement(1807)-g, adbSNP:141577445
complement(1809)-t, gdbSNP:142543645
complement(1820)-g, cdbSNP:139203165
complement(1821..1822)-, cdbSNP:145267004
complement(1833)-t, adbSNP:370585355
complement(1839)-g, adbSNP:201012043
complement(1844)-t, cdbSNP:138432536
complement(1847)-g, cdbSNP:375827793
complement(1895)-g, adbSNP:143156748
complement(1898)-g, cdbSNP:55942044
complement(1909)-t, cdbSNP:369435276
complement(1934)-dbSNP:
complement(1934)-t, cdbSNP:371219353
complement(1937)-g, adbSNP:370624765
complement(1945)-t, cdbSNP:201104874
complement(1951)-g, adbSNP:372747391
complement(1974)-t, cdbSNP:370659554
complement(1984)-g, adbSNP:139830484
1992+c, tdbSNP:41529644
complement(2009)-t, cdbSNP:376280561
complement(2029)-g, cdbSNP:200147916
complement(2052)-dbSNP:
complement(2052)-g, adbSNP:146386843
complement(2056)-g, adbSNP:149436601
2058+a, gdbSNP:281860268
complement(2091)-g, adbSNP:200788902
complement(2092)-t, cdbSNP:369426734
complement(2122)-t, gdbSNP:200536087
complement(2164)-dbSNP:
complement(2164)-c, adbSNP:139845496
complement(2177)-c, adbSNP:17854478
2189+a, gdbSNP:281860269
complement(2221)-g, adbSNP:184499252
complement(2222)-t, cdbSNP:371692872
2250+a, gdbSNP:397515555
complement(2280)-dbSNP:
complement(2280)-g, adbSNP:200489778
complement(2340)-g, adbSNP:368661705
complement(2343)-t, cdbSNP:150668652
complement(2356)-g, adbSNP:374465388
complement(2360)-t, cdbSNP:141866247
complement(2362)-t, gdbSNP:368857320
complement(2374)-t, cdbSNP:56316417
complement(2399)-g, adbSNP:111943087
complement(2404)-g, adbSNP:147072380
complement(2407)-t, cdbSNP:3733670
complement(2421)-t, cdbSNP:201569135
complement(2457)-dbSNP:
complement(2457)-t, gdbSNP:371017407
complement(2458)-g, adbSNP:376570011
complement(2459)-g, adbSNP:142978503
complement(2477)-t, cdbSNP:139061724
complement(2490)-g, adbSNP:373427460
complement(2500)-g, adbSNP:143167751
complement(2509)-g, cdbSNP:199915312
complement(2525)-dbSNP:
complement(2525)-g, cdbSNP:369879651
2531+a, gdbSNP:41355444
complement(2536)-g, cdbSNP:144976075
complement(2537)-g, adbSNP:373083937
complement(2545)-t, cdbSNP:376651450
complement(2549)-g, adbSNP:372068592
2589+c, tdbSNP:281860270
complement(2599)-g, adbSNP:199640967
2600+c, gdbSNP:281860271
2616+dbSNP:
2616+a, tdbSNP:281860273
2621+c, tdbSNP:397515556
complement(2635)-t, cdbSNP:55804445
2637+a, gdbSNP:281860281
2673+c, tdbSNP:281860274
complement(2728)-t, cdbSNP:367984340
2775+dbSNP:
2775+c, tdbSNP:397515557
complement(2791)-t, cdbSNP:149872699
complement(2800)-g, adbSNP:146691087
2801+g, tdbSNP:387906662
complement(2824)-g, adbSNP:55657214
complement(2827)-g, cdbSNP:56327604
complement(2834)-t, cdbSNP:200284956
2838..2840+, tctdbSNP:281860276
2838+c, tdbSNP:281860277
complement(2849)-dbSNP:
complement(2849)-g, adbSNP:372774226
complement(2891)-t, gdbSNP:139797829
2895+c, tdbSNP:281860278
2916+c, tdbSNP:281860279
2924+a, cdbSNP:281860280
complement(3001)-dbSNP:
complement(3001)-g, adbSNP:41287094
complement(3028)-t, cdbSNP:201061537
complement(3031)-g, cdbSNP:376605798
complement(3038)-t, cdbSNP:142435467
complement(3050)-t, cdbSNP:200925061
complement(3052)-g, cdbSNP:34030164
complement(3053)-g, adbSNP:202216061
complement(3054)-t, cdbSNP:56059682
complement(3061)-dbSNP:
complement(3061)-g, adbSNP:374290975
complement(3072)-g, adbSNP:144414073
complement(3091)-g, adbSNP:41287092
complement(3095)-t, cdbSNP:140118369
complement(3097)-g, adbSNP:147476583
complement(3133)-g, adbSNP:148054244
complement(3154)-g, adbSNP:56005231
complement(3155)-t, cdbSNP:200068110
complement(3178)-g, adbSNP:370648666
3197+c, tdbSNP:121913393
3198+a, g, tdbSNP:1801271
3199+a, tdbSNP:121913392
complement(3215)-c, adbSNP:376038713
complement(3221)-t, cdbSNP:374082775
complement(3235)-g, adbSNP:370469459
3246..3247+a, c, tdbSNP:397711183
complement(3246..3247)-tg, gadbSNP:386693509
3246+c, tdbSNP:2066933
3247+a, cdbSNP:2066934
complement(3247)-tg, gadbSNP:35308019
complement(3275)-g, adbSNP:144642625
complement(3293)-g, adbSNP:191000580
complement(3300)-, adbSNP:373754757
complement(3306)-g, adbSNP:142730720
complement(3327)-g, adbSNP:188032016
complement(3410)-t, cdbSNP:138239430
complement(3441..3442)-, cdbSNP:66970099
complement(3441)-t, gdbSNP:373205661
complement(3442..3443)-, gdbSNP:3216780
complement(3442)-g, cdbSNP:78449650
complement(3443..3444)-, cgg, gcdbSNP:72543477
complement(3444..3445)-, gdbSNP:200927456
complement(3445)-g, adbSNP:114947856
complement(3445)-, adbSNP:376905470
3521+a, cdbSNP:41497048
complement(3547)-g, adbSNP:182193643
3616+c, gdbSNP:1058920
complement(3617)-t, adbSNP:11546510
complement(3637)-g, cdbSNP:140616824
complement(3667)-g, adbSNP:369483275
3711+a, gdbSNP:138905856
3723+c, tdbSNP:13117
complement(3739)-g, adbSNP:189742476
complement(3742)-g, adbSNP:367836988
complement(3750)-g, adbSNP:373206666
3798+c, gdbSNP:9727
complement(3815)-t, cdbSNP:150244467
3846+c, tdbSNP:1058950
3943+a, cdbSNP:12500
complement(3953)-t, gdbSNP:373663045
complement(3980)-t, cdbSNP:3828609
complement(3985)-t, cdbSNP:371174880
Gene SymbolCSF1R
Gene SynonymC-FMS; CD115; CSF-1R; CSFR; FIM2; FMS; HDLS; M-CSF-R
Chromosome5
Locus Map5q32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005211 Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA. On-demand $279.00 12-14
NM_005211 Homo sapiens colony stimulating factor 1 receptor (CSF1R), transcript variant 1, mRNA. On-demand $279.00 12-14
Title CSF-1R expression in tumor-associated macrophages is associated with worse prognosis in classical Hodgkin lymphoma .
Author Koh YW, Park C, Yoon DH, Suh C and Huh J.
Journal Am. J. Clin. Pathol. 141 (4), 573-583 (2014)
Title Haploinsufficiency of CSF-1R and clinicopathologic characterization in patients with HDLS .
Author Konno T, Tada M, Tada M, Koyama A, Nozaki H, Harigaya Y, Nishimiya J, Matsunaga A, Yoshikura N, Ishihara K, Arakawa M, Isami A, Okazaki K, Yokoo H, Itoh K, Yoneda M, Kawamura M, Inuzuka T, Takahashi H, Nishizawa M, Onodera O, Kakita A and Ikeuchi T.
Journal Neurology 82 (2), 139-148 (2014)
Title M-CSF receptor mutations in hereditary diffuse leukoencephalopathy with spheroids impair not only kinase activity but also surface expression .
Author Hiyoshi M, Hashimoto M, Yukihara M, Bhuyan F and Suzu S.
Journal Biochem. Biophys. Res. Commun. 440 (4), 589-593 (2013)
Title A unique anti-CD115 monoclonal antibody which inhibits osteolysis and skews human monocyte differentiation from M2-polarized macrophages toward dendritic cells .
Author Haegel H, Thioudellet C, Hallet R, Geist M, Menguy T, Le Pogam F, Marchand JB, Toh ML, Duong V, Calcei A, Settelen N, Preville X, Hennequi M, Grellier B, Ancian P, Rissanen J, Clayette P, Guillen C, Rooke R and Bonnefoy JY.
Journal MAbs 5 (5), 736-747 (2013)
Title Leukodystrophy Overview .
Author Vanderver,A., Tonduti,D., Schiffmann,R., Schmidt,J. and Van der Knaap,M.S.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title CSF1R-Related Hereditary Diffuse Leukoencephalopathy with Spheroids .
Author Sundal,C. and Wszolek,Z.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Expression and characterization of the p85 subunit of the phosphatidylinositol 3-kinase complex and a related p85 beta protein by using the baculovirus expression system .
Author Gout I, Dhand R, Panayotou G, Fry MJ, Hiles I, Otsu M and Waterfield MD.
Journal Biochem. J. 288 (PT 2), 395-405 (1992)
Title Localization of the 5' end of the MCF2 oncogene to human chromosome 15q15----q23 .
Author Galland F, Stefanova M, Lafage M and Birnbaum D.
Journal Cytogenet. Cell Genet. 60 (2), 114-116 (1992)
Title Myc rescue of a mutant CSF-1 receptor impaired in mitogenic signalling .
Author Roussel MF, Cleveland JL, Shurtleff SA and Sherr CJ.
Journal Nature 353 (6342), 361-363 (1991)
Title Interactions of phosphatidylinositol kinase, GTPase-activating protein (GAP), and GAP-associated proteins with the colony-stimulating factor 1 receptor .
Author Reedijk M, Liu XQ and Pawson T.
Journal Mol. Cell. Biol. 10 (11), 5601-5608 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.