• THAT   AND
  • THAT   AND


Homo sapiens distal-less homeobox 5 (DLX5), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_005221 Homo sapiens distal-less homeobox 5 (DLX5), mRNA. Full Lenth $412.96
ORF Sequence $252.30


RefSeq Version NM_005221.5, 84043959
Length 1424 bp
Structure linear
Update Date 03-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens distal-less homeobox 5 (DLX5), mRNA.
Product homeobox protein DLX-5
Comment

Summary: This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq].

RefSeq NP_005212.1
CDS 209..1078
Exon (1)1..563
Exon (2)1..563
Exon (3)564..748
Exon (4)749..1424
Translation MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCS PTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK EVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH PPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(96)-g, adbSNP:117992772
complement(99)-g, adbSNP:116949278
complement(107)-g, adbSNP:118071371
complement(261)-t, cdbSNP:59322533
complement(460)-g, cdbSNP:61753628
910+a, c, gdbSNP:35273378
complement(1234..1235)-, gdbSNP:3214218
complement(1240..1241)-, gdbSNP:63320562
complement(1241..1242)-, t, g, c, adbSNP:5886002
complement(1241..1242)-, gdbSNP:112772747
complement(1242)-g, adbSNP:77382615
Gene SymbolDLX5
Gene SynonymDLX5
Chromosome7
Locus Map7q22
All Transcripts NM_005221
Title Upregulation of DLX5 promotes ovarian cancer cell proliferation by enhancing IRS-2-AKT signaling .
Author Tan,Y., Cheung,M., Pei,J., Menges,C.W., Godwin,A.K. and Testa,J.R.
Journal Cancer Res. 70 (22), 9197-9206 (2010)
Title Genome-wide profiling of p63 DNA-binding sites identifies an element that regulates gene expression during limb development in the 7q21 SHFM1 locus .
Author Kouwenhoven,E.N., van Heeringen,S.J., Tena,J.J., Oti,M., Dutilh,B.E., Alonso,M.E., de la Calle-Mustienes,E., Smeenk,L., Rinne,T., Parsaulian,L., Bolat,E., Jurgelenaite,R., Huynen,M.A., Hoischen,A., Veltman,J.A., Brunner,H.G., Roscioli,T., Oates,E., Wilson,M., Manzanares,M., Gomez-Skarmeta,J.L., Stunnenberg,H.G., Lohrum,M., van Bokhoven,H. and Zhou,H.
Journal PLoS Genet. 6 (8), E1001065 (2010)
Title Mutually exclusive expression of DLX2 and DLX5/6 is associated with the metastatic potential of the human breast cancer cell line MDA-MB-231 .
Author Morini,M., Astigiano,S., Gitton,Y., Emionite,L., Mirisola,V., Levi,G. and Barbieri,O.
Journal BMC Cancer 10, 649 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
Journal PLoS ONE 5 (7), E11493 (2010)
Title DLX5 (distal-less homeobox 5) promotes tumor cell proliferation by transcriptionally regulating MYC .
Author Xu,J. and Testa,J.R.
Journal J. Biol. Chem. 284 (31), 20593-20601 (2009)
Title DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation .
Author Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A., Ghattas,I., Puelles,L. and Rubenstein,J.L.
Journal J. Comp. Neurol. 414 (2), 217-237 (1999)
Title The RRM domain of MINT, a novel Msx2 binding protein, recognizes and regulates the rat osteocalcin promoter .
Author Newberry,E.P., Latifi,T. and Towler,D.A.
Journal Biochemistry 38 (33), 10678-10690 (1999)
Title Heterodimerization of Msx and Dlx homeoproteins results in functional antagonism .
Author Zhang,H., Hu,G., Wang,H., Sciavolino,P., Iler,N., Shen,M.M. and Abate-Shen,C.
Journal Mol. Cell. Biol. 17 (5), 2920-2932 (1997)
Title Physical mapping of the split hand/split foot locus on chromosome 7 and implication in syndromic ectrodactyly .
Author Scherer,S.W., Poorkaj,P., Massa,H., Soder,S., Allen,T., Nunes,M., Geshuri,D., Wong,E., Belloni,E., Little,S. et al.
Journal Hum. Mol. Genet. 3 (8), 1345-1354 (1994)
Title Cloning and characterization of two members of the vertebrate Dlx gene family .
Author Simeone,A., Acampora,D., Pannese,M., D'Esposito,M., Stornaiuolo,A., Gulisano,M., Mallamaci,A., Kastury,K., Druck,T., Huebner,K. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (6), 2250-2254 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878