• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens distal-less homeobox 5 (DLX5), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18344 Homo sapiens distal-less homeobox 5 (DLX5), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu18344C Homo sapiens distal-less homeobox 5 (DLX5), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005221.5, 84043959
Length 870 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens distal-less homeobox 5 (DLX5), mRNA.
Product homeobox protein DLX-5
Comment

Summary: This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq, Jul 2008].

RefSeq NP_005212.1
CDS 209..1078
Misc Feature(1)203..205
Misc Feature(2)302..562
Misc Feature(3)302..562
Misc Feature(4)620..790
Misc Feature(5)order(620..634,638..640,689..691,707..709,746..748,
Misc Feature(6)order(626..628,635..637,755..757,764..769,776..778)
Exon (1)1..563
Gene:DLX5
Gene Synonym:SHFM1D
Exon (2)564..748
Gene:DLX5
Gene Synonym:SHFM1D
Exon (3)749..1424
Gene:DLX5
Gene Synonym:SHFM1D
Translation MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCS PTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK EVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH PPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(40)-dbSNP:
complement(40)-t, adbSNP:188114093
complement(168)-t, cdbSNP:367882028
complement(205)-t, cdbSNP:375295363
complement(261)-t, cdbSNP:59322533
complement(280)-g, adbSNP:367692677
complement(310)-g, cdbSNP:147904307
complement(346)-t, gdbSNP:370973096
complement(391)-g, adbSNP:144772458
complement(395)-t, adbSNP:140706964
complement(433)-g, adbSNP:377762040
complement(438)-t, cdbSNP:147255037
complement(447)-g, adbSNP:149635296
complement(460)-g, cdbSNP:61753628
complement(466)-g, adbSNP:150866607
complement(470)-g, adbSNP:376161860
complement(474)-t, gdbSNP:141521941
complement(520)-g, adbSNP:200820594
complement(521)-t, cdbSNP:267601653
complement(531)-t, cdbSNP:371127948
complement(541)-g, cdbSNP:201376176
complement(545)-t, cdbSNP:201841970
complement(572)-dbSNP:
complement(572)-g, cdbSNP:201233212
complement(579)-t, cdbSNP:372558150
complement(598)-t, cdbSNP:138986105
complement(602)-t, cdbSNP:185529928
complement(664)-t, cdbSNP:369530818
complement(704)-t, cdbSNP:376488297
complement(709)-g, adbSNP:370011783
741+a, cdbSNP:387906737
766+dbSNP:
766+g, tdbSNP:398122527
complement(788)-t, gdbSNP:199567160
complement(815)-g, adbSNP:146762155
complement(816)-g, cdbSNP:145966633
complement(835)-g, adbSNP:371922223
complement(898)-g, adbSNP:368292584
complement(900)-t, cdbSNP:142492086
complement(904)-t, cdbSNP:371372992
complement(910)-g, c, adbSNP:35273378
complement(916)-t, gdbSNP:143457052
complement(920)-t, gdbSNP:148894146
complement(924)-g, cdbSNP:200799043
complement(926)-g, adbSNP:201666211
complement(937)-g, adbSNP:370171925
complement(960)-t, cdbSNP:376879283
complement(964)-g, adbSNP:372846518
complement(968)-g, cdbSNP:199725569
complement(972)-t, cdbSNP:369140826
complement(1028)-g, cdbSNP:199678276
complement(1043)-g, adbSNP:138650319
complement(1099)-g, adbSNP:200468189
complement(1234..1235)-, gdbSNP:397692728
complement(1241..1242)-t, g, c, adbSNP:5886002
complement(1241..1242)-, gdbSNP:3214218
complement(1242)-g, adbSNP:77382615
Gene SymbolDLX5
Gene SynonymSHFM1D
Chromosome7
Locus Map7q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005221 Homo sapiens distal-less homeobox 5 (DLX5), mRNA. In-stock $99.00 5-7
NM_005221 Homo sapiens distal-less homeobox 5 (DLX5), mRNA. In-stock $99.00 5-7
Title Methylation alterations at imprinted genes detected among long-term shiftworkers .
Author Jacobs DI, Hansen J, Fu A, Stevens RG, Tjonneland A, Vogel UB, Zheng T and Zhu Y.
Journal Environ. Mol. Mutagen. 54 (2), 141-146 (2013)
Title A 0.7 Mb de novo duplication at 7q21.3 including the genes DLX5 and DLX6 in a patient with split-hand/split-foot malformation .
Author Velinov M, Ahmad A, Brown-Kipphut B, Shafiq M, Blau J, Cooma R, Roth P and Iqbal MA.
Journal Am. J. Med. Genet. A 158A (12), 3201-3206 (2012)
Title Rapp-Hodgkin syndrome and SHFM1 patients: delineating the p63-Dlx5/Dlx6 pathway .
Author Vera-Carbonell A, Moya-Quiles MR, Ballesta-Martinez M, Lopez-Gonzalez V, Bafalliu JA, Guillen-Navarro E and Lopez-Exposito I.
Journal Gene 497 (2), 292-297 (2012)
Title Identification of a novel DLX5 mutation in a family with autosomal recessive split hand and foot malformation .
Author Shamseldin HE, Faden MA, Alashram W and Alkuraya FS.
Journal J. Med. Genet. 49 (1), 16-20 (2012)
Title [Changes in the expression of Dlx5, Msx2, and Dlx5/Msx2 in hPDLSCs loaded with cyclic tensile stress] .
Author Sun CX, Zhang LK, Feng XX and Zhao ZH.
Journal Sichuan Da Xue Xue Bao Yi Xue Ban 42 (6), 823-826 (2011)
Title DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation .
Author Eisenstat DD, Liu JK, Mione M, Zhong W, Yu G, Anderson SA, Ghattas I, Puelles L and Rubenstein JL.
Journal J. Comp. Neurol. 414 (2), 217-237 (1999)
Title The RRM domain of MINT, a novel Msx2 binding protein, recognizes and regulates the rat osteocalcin promoter .
Author Newberry EP, Latifi T and Towler DA.
Journal Biochemistry 38 (33), 10678-10690 (1999)
Title Heterodimerization of Msx and Dlx homeoproteins results in functional antagonism .
Author Zhang H, Hu G, Wang H, Sciavolino P, Iler N, Shen MM and Abate-Shen C.
Journal Mol. Cell. Biol. 17 (5), 2920-2932 (1997)
Title Physical mapping of the split hand/split foot locus on chromosome 7 and implication in syndromic ectrodactyly .
Author Scherer SW, Poorkaj P, Massa H, Soder S, Allen T, Nunes M, Geshuri D, Wong E, Belloni E and Little S.
Journal Hum. Mol. Genet. 3 (8), 1345-1354 (1994)
Title Cloning and characterization of two members of the vertebrate Dlx gene family .
Author Simeone A, Acampora D, Pannese M, D'Esposito M, Stornaiuolo A, Gulisano M, Mallamaci A, Kastury K, Druck T and Huebner K.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (6), 2250-2254 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.