Sequence in raw or FASTA format:
Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA.
| RefSeq Version | NM_005233.5, 156547090 |
| Length | 5837 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA. |
| Product | ephrin type-A receptor 3 isoform a precursor |
| Comment | Summary: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (a). |
| RefSeq | NP_005224.2 |
| CDS | 226..3177 | Exon (1) | 1..313 | Exon (2) | 1..313 | Exon (3) | 314..378 | Exon (4) | 379..1039 | Exon (5) | 1040..1195 | Exon (6) | 1196..1531 | Exon (7) | 1532..1656 | Exon (8) | 1657..1819 | Exon (9) | 1820..1922 | Exon (10) | 1923..1987 | Exon (11) | 1988..2113 | Exon (12) | 2114..2299 | Exon (13) | 2300..2361 | Exon (14) | 2362..2571 | Exon (15) | 2572..2721 | Exon (16) | 2722..2915 | Exon (17) | 2916..3071 | Exon (18) | 3072..5809 |
| Translation | MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | EPHA3 |
| Gene Synonym | EK4; ETK; ETK1; HEK; HEK4; TYRO4 |
| Chromosome | 3 |
| Locus Map | 3p11.2 |
| All Transcripts | NM_005233 , NM_182644 |
| Title | Multiple tumor-suppressor genes on chromosome 3p contribute to head and neck squamous cell carcinoma tumorigenesis . |
| Author | Lee,D.J., Schonleben,F., Banuchi,V.E., Qiu,W., Close,L.G., Assaad,A.M. and Su,G.H. |
| Journal | Cancer Biol. Ther. 10 (7), 689-693 (2010) |
| Title | Somatic mutations and germline sequence variants in patients with familial colorectal cancer . |
| Author | Gylfe,A.E., Sirkia,J., Ahlsten,M., Jarvinen,H., Mecklin,J.P., Karhu,A. and Aaltonen,L.A. |
| Journal | Int. J. Cancer (2010) In press |
| Title | Exploring the link between germline and somatic genetic alterations in breast carcinogenesis . |
| Author | Bonifaci,N., Gorski,B., Masojc,B., Wokolorczyk,D., Jakubowska,A., Debniak,T., Berenguer,A., Serra Musach,J., Brunet,J., Dopazo,J., Narod,S.A., Lubinski,J., Lazaro,C., Cybulski,C. and Pujana,M.A. |
| Journal | PLoS ONE 5 (11), E14078 (2010) |
| Title | Mutational profiling of kinases in human tumours of pancreatic origin identifies candidate cancer genes in ductal and ampulla of vater carcinomas . |
| Author | Corbo,V., Ritelli,R., Barbi,S., Funel,N., Campani,D., Bardelli,A. and Scarpa,A. |
| Journal | PLoS ONE 5 (9), E12653 (2010) |
| Title | Structural recognition of an optimized substrate for the ephrin family of receptor tyrosine kinases . |
| Author | Davis,T.L., Walker,J.R., Allali-Hassani,A., Parker,S.A., Turk,B.E. and Dhe-Paganon,S. |
| Journal | FEBS J. 276 (16), 4395-4404 (2009) |
| Title | Isolation of LERK-5: a ligand of the eph-related receptor tyrosine kinases . |
| Author | Cerretti,D.P., Vanden Bos,T., Nelson,N., Kozlosky,C.J., Reddy,P., Maraskovsky,E., Park,L.S., Lyman,S.D., Copeland,N.G., Gilbert,D.J. et al. |
| Journal | Mol. Immunol. 32 (16), 1197-1205 (1995) |
| Title | Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors . |
| Author | Beckmann,M.P., Cerretti,D.P., Baum,P., Vanden Bos,T., James,L., Farrah,T., Kozlosky,C., Hollingsworth,T., Shilling,H., Maraskovsky,E. et al. |
| Journal | EMBO J. 13 (16), 3757-3762 (1994) |
| Title | Localization of a human receptor tyrosine kinase (ETK1) to chromosome region 3p11.2 . |
| Author | Wicks,I.P., Lapsys,N.M., Baker,E., Campbell,L.J., Boyd,A.W. and Sutherland,G.R. |
| Journal | Genomics 19 (1), 38-41 (1994) |
| Title | Molecular cloning of HEK, the gene encoding a receptor tyrosine kinase expressed by human lymphoid tumor cell lines . |
| Author | Wicks,I.P., Wilkinson,D., Salvaris,E. and Boyd,A.W. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 89 (5), 1611-1615 (1992) |
| Title | Isolation and characterization of a novel receptor-type protein tyrosine kinase (hek) from a human pre-B cell line . |
| Author | Boyd,A.W., Ward,L.D., Wicks,I.P., Simpson,R.J., Salvaris,E., Wilks,A., Welch,K., Loudovaris,M., Rockman,S. and Busmanis,I. |
| Journal | J. Biol. Chem. 267 (5), 3262-3267 (1992) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |