• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005233 Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_005233.5, 156547090
Length 5837 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA.
Product ephrin type-A receptor 3 isoform a precursor
Comment

Summary: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) encodes the longer isoform (a).

RefSeq NP_005224.2
CDS 226..3177
Misc Feature(1)136..138
Misc Feature(2)310..828
Misc Feature(3)order(382..384,388..402,421..426,430..432,436..438,
Misc Feature(4)<1033..1128
Misc Feature(5)1201..1521
Misc Feature(6)order(1201..1203,1426..1428,1465..1467)
Misc Feature(7)order(1468..1473,1477..1482)
Misc Feature(8)1534..1809
Misc Feature(9)order(1534..1536,1726..1728,1771..1773)
Misc Feature(10)order(1774..1779,1783..1788)
Misc Feature(11)1849..1920
Misc Feature(12)1888..2079
Misc Feature(13)2011..2013
Misc Feature(14)2011..2013
Misc Feature(15)2029..2031
Misc Feature(16)2029..2031
Misc Feature(17)2071..2871
Misc Feature(18)2086..2859
Misc Feature(19)order(2104..2106,2110..2118,2128..2130,2176..2178,
Misc Feature(20)order(2104..2106,2113..2118,2176..2178,2182..2184,
Misc Feature(21)2326..2328
Misc Feature(22)order(2461..2463,2473..2475,2572..2586,2611..2613,
Misc Feature(23)2512..2592
Misc Feature(24)2560..2562
Misc Feature(25)2560..2562
Misc Feature(26)2947..3150
Misc Feature(27)2959..3147
Misc Feature(28)3166..3174
Exon (1)1..313
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (2)314..378
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (3)379..1039
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (4)1040..1195
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (5)1196..1531
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (6)1532..1656
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (7)1657..1819
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (8)1820..1922
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (9)1923..1987
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (10)1988..2113
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (11)2114..2299
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (12)2300..2361
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (13)2362..2571
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (14)2572..2721
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (15)2722..2915
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (16)2916..3071
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Exon (17)3072..5809
Gene:EPHA3
Gene Synonym:EK4; ETK; ETK1; HEK; HEK4; TYRO4
Translation MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG PQKKIISSIKALETQSKNGPVPV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
19+dbSNP:
19+a, gdbSNP:13074375
22+a, cdbSNP:184354535
25+a, gdbSNP:147840036
157+c, tdbSNP:111643515
186+a, tdbSNP:188399674
211+c, gdbSNP:72919864
266+c, tdbSNP:369721497
268+g, tdbSNP:373387079
274+c, gdbSNP:201110271
286+a, gdbSNP:141456190
297+g, tdbSNP:200437524
346+dbSNP:
346+a, gdbSNP:374211029
352+a, gdbSNP:368633855
353+c, gdbSNP:372273179
360+c, gdbSNP:139262347
393+dbSNP:
393+c, tdbSNP:149992625
448+a, gdbSNP:267599943
491+a, gdbSNP:142484873
503+a, tdbSNP:371194762
507+g, tdbSNP:369150999
510+a, tdbSNP:200290249
568+a, gdbSNP:200995645
570+g, tdbSNP:141613520
582+a, tdbSNP:184977302
596+a, gdbSNP:202143347
610+a, gdbSNP:201357801
615+c, tdbSNP:113122729
636+g, tdbSNP:373433238
670..671+, cdbSNP:34813653
743+c, tdbSNP:141287594
846+g, tdbSNP:200567888
870+a, gdbSNP:371307327
909+a, gdbSNP:143609637
924+c, tdbSNP:374742013
934+a, gdbSNP:139652107
947+c, gdbSNP:370457091
969+c, tdbSNP:150099876
1019+a, gdbSNP:138376716
1025+a, gdbSNP:138974536
1039+g, tdbSNP:374955351
1048+dbSNP:
1048+c, tdbSNP:201468736
1066+c, tdbSNP:182691254
1075+a, cdbSNP:200484511
1117+c, gdbSNP:142109561
1144+a, gdbSNP:148593404
1176+a, tdbSNP:368359032
1206+dbSNP:
1206+c, tdbSNP:140674679
1232+c, tdbSNP:368542690
1236+c, tdbSNP:201113556
1249+a, cdbSNP:372301564
1258+c, tdbSNP:374701071
1286+a, gdbSNP:144727411
1294+a, gdbSNP:149937883
1309+a, gdbSNP:367816678
1310+c, tdbSNP:202046045
1345+a, gdbSNP:371687854
1355+a, gdbSNP:200415022
1434+g, tdbSNP:369310617
1487+a, cdbSNP:144998277
1506+a, gdbSNP:56112995
1550+dbSNP:
1550+c, tdbSNP:112239794
1567+a, tdbSNP:372621625
1635+c, tdbSNP:377110805
1646+a, gdbSNP:370552845
1670+dbSNP:
1670+c, tdbSNP:370986773
1681+a, gdbSNP:374626393
1695+a, gdbSNP:369947693
1719+a, cdbSNP:144696297
1729+a, gdbSNP:75391524
1799+a, tdbSNP:150469112
1815+a, gdbSNP:368660040
1834+dbSNP:
1834+a, gdbSNP:371787296
1848+a, tdbSNP:149643424
1849+c, gdbSNP:377041029
1851+a, gdbSNP:56330723
1860+c, tdbSNP:200724434
1871+c, tdbSNP:147450955
1873+c, gdbSNP:371462790
1879+a, gdbSNP:142865154
1903+a, gdbSNP:374460085
1907+a, gdbSNP:139544432
1915+a, gdbSNP:55712516
1927+dbSNP:
1927+a, tdbSNP:56077781
1934+a, gdbSNP:370678502
1947+c, tdbSNP:145276281
1949+c, gdbSNP:372943443
1983+a, gdbSNP:376205829
1994+dbSNP:
1994+c, tdbSNP:56081642
2011..2012+, tdbSNP:35329896
2014+a, gdbSNP:61733120
2047+a, gdbSNP:17855794
2071+c, tdbSNP:371156113
2074+g, tdbSNP:374235660
2134+dbSNP:
2134+a, gdbSNP:375432691
2139+c, tdbSNP:148141668
2153+c, gdbSNP:146728702
2160+a, gdbSNP:143310803
2166+g, tdbSNP:201062946
2169+c, tdbSNP:138119313
2178+c, tdbSNP:148670200
2211+a, gdbSNP:146238137
2260+c, tdbSNP:202059523
2276+a, gdbSNP:372257039
2279+c, tdbSNP:200071736
2291+c, tdbSNP:139451236
2356+dbSNP:
2356+c, tdbSNP:57909419
2358+a, cdbSNP:140661567
2363+dbSNP:
2363+a, cdbSNP:199630398
2383+a, gdbSNP:200791821
2392+c, gdbSNP:375846678
2458+c, tdbSNP:369276620
2462+a, cdbSNP:149696182
2469+c, tdbSNP:56175540
2500+a, gdbSNP:146856660
2555+c, gdbSNP:34437982
complement(2625)-dbSNP:
complement(2625)-t, cdbSNP:1398197
2627+a, tdbSNP:73139269
2630+c, gdbSNP:369423490
2631+a, gdbSNP:372376671
2673+a, gdbSNP:377302282
2683+c, tdbSNP:150609332
2691+c, gdbSNP:370863541
2706+g, tdbSNP:374248537
2761+dbSNP:
2761+c, gdbSNP:142030914
2772+c, tdbSNP:144153931
2817+c, tdbSNP:148616739
2859+c, gdbSNP:142081551
2874+a, gdbSNP:145084709
2881+g, tdbSNP:373736475
2896+a, gdbSNP:367573076
2909+c, tdbSNP:141716319
2910+c, tdbSNP:76565471
2925+dbSNP:
2925+c, tdbSNP:267599944
2946+c, tdbSNP:73846185
2950+a, gdbSNP:374961385
2966+a, gdbSNP:17801309
2995+c, tdbSNP:35124509
2996+a, gdbSNP:150555764
3023+c, tdbSNP:372594677
3027+c, tdbSNP:1054750
3030+a, gdbSNP:376077635
3031+a, gdbSNP:369167718
3065+a, cdbSNP:192800580
3066+c, tdbSNP:145149969
3111+dbSNP:
3111+a, gdbSNP:55836286
3169+c, tdbSNP:147992008
3171+c, tdbSNP:147581559
3183+a, gdbSNP:199509777
3203+a, cdbSNP:370543090
3204+a, gdbSNP:373647562
3214+g, tdbSNP:368077321
3217+a, gdbSNP:370542017
3226+a, gdbSNP:201042153
3332+a, gdbSNP:183966245
3349..3350+, cdbSNP:36097210
3473+c, tdbSNP:3762717
3578+a, gdbSNP:188207366
3702+a, gdbSNP:73139144
4045+a, tdbSNP:202222982
4050+c, tdbSNP:76905803
4173+a, cdbSNP:182032149
4185+c, gdbSNP:186325629
4209+c, tdbSNP:191674555
4210+a, gdbSNP:141674458
4217+a, gdbSNP:367907459
4229+a, gdbSNP:181612461
4270+a, cdbSNP:199684787
4295..4296+, adbSNP:375610237
4295+a, tdbSNP:74438214
4323+c, gdbSNP:201083429
4514+c, tdbSNP:186377358
4570+g, tdbSNP:376414424
4582..4583+at, ccdbSNP:386663330
4582+a, cdbSNP:7650184
4583+c, tdbSNP:73846200
4630+g, tdbSNP:191581645
4778+a, cdbSNP:372298146
4803+a, gdbSNP:182509403
4872+a, gdbSNP:73139147
4883+c, tdbSNP:7650466
5018..5019+, cdbSNP:34215402
5077+c, tdbSNP:186746038
5087+c, tdbSNP:372908121
5253+a, gdbSNP:150121394
5481+a, gdbSNP:73139148
5497..5498+, tdbSNP:34339302
5530+a, gdbSNP:138605369
5573+c, tdbSNP:189642147
5728+a, cdbSNP:142920086
Gene SymbolEPHA3
Gene SynonymEK4; ETK; ETK1; HEK; HEK4; TYRO4
Chromosome3
Locus Map3p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_182644 Homo sapiens EPH receptor A3 (EPHA3), transcript variant 2, mRNA. On-demand $699.00 18
NM_005233 Homo sapiens EPH receptor A3 (EPHA3), transcript variant 1, mRNA. On-demand $899.00 20
XM_005264715 PREDICTED: Homo sapiens EPH receptor A3 (EPHA3), transcript variant X1, mRNA. On-demand $899.00 20
XM_005264716 PREDICTED: Homo sapiens EPH receptor A3 (EPHA3), transcript variant X2, mRNA. On-demand $899.00 20
Title Genome-wide association study of chronic periodontitis in a general German population .
Author Teumer A, Holtfreter B, Volker U, Petersmann A, Nauck M, Biffar R, Volzke H, Kroemer HK, Meisel P, Homuth G and Kocher T.
Journal J. Clin. Periodontol. 40 (11), 977-985 (2013)
Title High levels of EphA3 expression are associated with high invasive capacity and poor overall survival in hepatocellular carcinoma .
Author Lu CY, Yang ZX, Zhou L, Huang ZZ, Zhang HT, Li J, Tao KS and Xie BZ.
Journal Oncol. Rep. 30 (5), 2179-2186 (2013)
Title A high-content cellular senescence screen identifies candidate tumor suppressors, including EPHA3 .
Author Lahtela J, Corson LB, Hemmes A, Brauer MJ, Koopal S, Lee J, Hunsaker TL, Jackson PK and Verschuren EW.
Journal Cell Cycle 12 (4), 625-634 (2013)
Title EphA3 maintains tumorigenicity and is a therapeutic target in glioblastoma multiforme .
Author Day BW, Stringer BW, Al-Ejeh F, Ting MJ, Wilson J, Ensbey KS, Jamieson PR, Bruce ZC, Lim YC, Offenhauser C, Charmsaz S, Cooper LT, Ellacott JK, Harding A, Leveque L, Inglis P, Allan S, Walker DG, Lackmann M, Osborne G, Khanna KK, Reynolds BA, Lickliter JD and Boyd AW.
Journal Cancer Cell 23 (2), 238-248 (2013)
Title Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci .
Author Ludwig KU, Mangold E, Herms S, Nowak S, Reutter H, Paul A, Becker J, Herberz R, AlChawa T, Nasser E, Bohmer AC, Mattheisen M, Alblas MA, Barth S, Kluck N, Lauster C, Braumann B, Reich RH, Hemprich A, Potzsch S, Blaumeiser B, Daratsianos N, Kreusch T, Murray JC, Marazita ML, Ruczinski I, Scott AF, Beaty TH, Kramer FJ, Wienker TF, Steegers-Theunissen RP, Rubini M, Mossey PA, Hoffmann P, Lange C, Cichon S, Propping P, Knapp M and Nothen MM.
Journal Nat. Genet. 44 (9), 968-971 (2012)
Title Isolation of LERK-5: a ligand of the eph-related receptor tyrosine kinases .
Author Cerretti DP, Vanden Bos T, Nelson N, Kozlosky CJ, Reddy P, Maraskovsky E, Park LS, Lyman SD, Copeland NG and Gilbert DJ.
Journal Mol. Immunol. 32 (16), 1197-1205 (1995)
Title Molecular characterization of a family of ligands for eph-related tyrosine kinase receptors .
Author Beckmann MP, Cerretti DP, Baum P, Vanden Bos T, James L, Farrah T, Kozlosky C, Hollingsworth T, Shilling H and Maraskovsky E.
Journal EMBO J. 13 (16), 3757-3762 (1994)
Title Localization of a human receptor tyrosine kinase (ETK1) to chromosome region 3p11.2 .
Author Wicks IP, Lapsys NM, Baker E, Campbell LJ, Boyd AW and Sutherland GR.
Journal Genomics 19 (1), 38-41 (1994)
Title Molecular cloning of HEK, the gene encoding a receptor tyrosine kinase expressed by human lymphoid tumor cell lines .
Author Wicks IP, Wilkinson D, Salvaris E and Boyd AW.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (5), 1611-1615 (1992)
Title Isolation and characterization of a novel receptor-type protein tyrosine kinase (hek) from a human pre-B cell line .
Author Boyd AW, Ward LD, Wicks IP, Simpson RJ, Salvaris E, Wilks A, Welch K, Loudovaris M, Rockman S and Busmanis I.
Journal J. Biol. Chem. 267 (5), 3262-3267 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.