• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementation group 4 (ERCC4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18825 Homo sapiens excision repair cross-complementation group 4 (ERCC4), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu18825C Homo sapiens excision repair cross-complementation group 4 (ERCC4), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005236.2, 164518896
Length 2751 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementation group 4 (ERCC4), mRNA.
Product DNA repair endonuclease XPF
Comment

Summary: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause of xeroderma pigmentosum complementation group F (XP-F), or xeroderma pigmentosum VI (XP6).[provided by RefSeq, Mar 2009].

RefSeq NP_005227.1
CDS 10..2760
Misc Feature(1)10..1380
Misc Feature(2)10..1380
Misc Feature(3)298..2730
Misc Feature(4)706..771
Misc Feature(5)817..903
Misc Feature(6)874..876
Misc Feature(7)1465..1482
Misc Feature(8)1567..1569
Misc Feature(9)1570..1572
Misc Feature(10)1579..1581
Misc Feature(11)1981..2448
Misc Feature(12)2065..2457
Misc Feature(13)2518..2724
Exon (1)1..216
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (2)217..397
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (3)398..593
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (4)594..801
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (5)802..982
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (6)983..1111
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (7)1112..1222
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (8)1223..1820
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (9)1821..1913
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (10)1914..2026
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (11)2027..6761
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Translation MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVL VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLT DRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKEL KCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEK MEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST KERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSS DAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGT ASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTP EMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEIS SNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF IHTSFAEVVSKGKGKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
13+a, gdbSNP:373789508
17+c, tdbSNP:148904556
18+a, cdbSNP:375831794
25+c, tdbSNP:61760160
42+c, tdbSNP:3136042
46+g, tdbSNP:374243778
48+a, gdbSNP:112419956
52+c, tdbSNP:140734311
58+g, tdbSNP:368281878
72+c, gdbSNP:375896908
78+a, gdbSNP:201606798
92+a, gdbSNP:367608263
complement(106)-g, cdbSNP:34205098
109+c, gdbSNP:61731714
118+c, tdbSNP:144602005
220+dbSNP:
220+c, tdbSNP:145315496
226+a, gdbSNP:141591400
234+a, gdbSNP:192488568
237+a, gdbSNP:61760162
250+a, g, tdbSNP:55761944
261+c, tdbSNP:3136056
266+a, gdbSNP:187435008
268+c, tdbSNP:191886782
269+a, gdbSNP:371487368
314+a, cdbSNP:144408815
334+a, gdbSNP:148791570
336+a, gdbSNP:377085353
360+c, tdbSNP:189742296
376+a, gdbSNP:144666685
429+dbSNP:
429+c, tdbSNP:138724289
435+a, tdbSNP:147455220
456+g, tdbSNP:139989614
457+a, cdbSNP:145402255
458+a, gdbSNP:377014538
467+c, gdbSNP:121913050
480+a, gdbSNP:3136092
484+c, gdbSNP:181993439
512+c, g, tdbSNP:2020961
541+g, tdbSNP:149927607
546+a, gdbSNP:373408411
564+c, tdbSNP:113129434
583+c, tdbSNP:377547617
661+dbSNP:
661+a, gdbSNP:145138851
698+c, tdbSNP:397509402
709+a, cdbSNP:368218302
712+a, gdbSNP:141101671
715+c, tdbSNP:397509403
737+a, gdbSNP:144608823
739+a, cdbSNP:201176880
746+c, tdbSNP:370864937
747+a, gdbSNP:146650135
785+a, gdbSNP:140299888
808+dbSNP:
808+c, tdbSNP:373570729
809+g, tdbSNP:143479220
855+a, gdbSNP:200536315
884+a, gdbSNP:202243691
915+c, tdbSNP:148003381
932+a, tdbSNP:141961015
943+g, tdbSNP:200596978
947+c, tdbSNP:150244523
975..976+, tdbSNP:35090754
1031+dbSNP:
1031+c, gdbSNP:373229910
1034+a, gdbSNP:267604416
1040+a, tdbSNP:145851520
1054+a, gdbSNP:201410515
1078..1079+, adbSNP:34607888
1111+a, gdbSNP:148933357
1132+dbSNP:
1132+c, tdbSNP:376695854
1144+c, tdbSNP:1799802
1156+a, gdbSNP:201051665
1171+c, tdbSNP:199505105
1210+c, tdbSNP:147458778
1213+a, gdbSNP:200759609
1252+dbSNP:
1252+c, tdbSNP:374470560
1253+a, gdbSNP:1800067
1275+a, cdbSNP:181278137
1277+a, gdbSNP:143924094
1278+c, tdbSNP:144305111
1293+a, gdbSNP:3136151
1306+c, tdbSNP:116615540
1327+g, tdbSNP:370344307
1343+a, cdbSNP:368559924
1375+a, gdbSNP:142332295
1385+a, cdbSNP:201179693
1407+c, gdbSNP:372950439
1438+c, tdbSNP:41557814
1455+a, gdbSNP:114077770
1479..1480+, gdbSNP:34930410
1493..1497+, ctcaadbSNP:397509400
1497+a, tdbSNP:146601373
1501+g, tdbSNP:140252818
1502+c, tdbSNP:373587423
1510+c, gdbSNP:371114175
1540+a, gdbSNP:200617058
1548+a, gdbSNP:374391979
1550+a, gdbSNP:201514032
1558+a, gdbSNP:150291286
1572+c, gdbSNP:41552412
1586+c, tdbSNP:149056863
1590+a, tdbSNP:200649435
1615+c, gdbSNP:143347563
1628+c, tdbSNP:368830992
1640..1641+, tdbSNP:369082850
1657+c, tdbSNP:139197943
1666+a, gdbSNP:376216413
1685+a, gdbSNP:370896187
1693+a, gdbSNP:55736359
1736+c, gdbSNP:1800068
1739..1740+, adbSNP:397509404
1741+a, gdbSNP:202186213
1749+g, tdbSNP:374556359
1767+c, gdbSNP:367595904
1772+c, tdbSNP:371392134
1774+c, tdbSNP:147105770
1797+g, tdbSNP:374303503
1811+a, cdbSNP:138532294
1826+dbSNP:
1826+a, tdbSNP:189463122
1830+g, tdbSNP:61760161
1861+c, tdbSNP:373565480
1880+a, gdbSNP:180919656
1893+a, gdbSNP:2020958
1893+a, gdbSNP:386552868
1926+dbSNP:
1926+a, cdbSNP:377213481
1949+a, gdbSNP:112490976
1951+a, gdbSNP:369471816
1992+a, gdbSNP:373237850
1993+c, tdbSNP:2020955
2009+a, cdbSNP:200317919
2016+g, tdbSNP:376422457
2017+c, tdbSNP:139782718
2018+a, gdbSNP:56129764
2021+a, gdbSNP:201675333
2039+dbSNP:
2039+a, gdbSNP:370466614
2074+a, cdbSNP:149364215
2114+a, gdbSNP:144058769
2126+c, tdbSNP:1800069
2133+a, cdbSNP:376391395
2134+a, gdbSNP:373906926
2178+a, cdbSNP:2020959
2186+a, gdbSNP:368096448
2195+c, tdbSNP:375860375
2199+c, tdbSNP:368274574
2208+c, tdbSNP:372425414
2227+c, tdbSNP:376688194
2242+g, tdbSNP:12932917
2249+c, tdbSNP:12928616
2250+c, tdbSNP:367813650
2257+c, tdbSNP:374978891
2270+a, gdbSNP:143357336
2275+a, gdbSNP:201501958
2299+a, gdbSNP:146764714
2301+c, tdbSNP:139406689
2305+a, cdbSNP:142532415
2312+c, tdbSNP:12928650
2314+c, tdbSNP:373135011
2323+c, tdbSNP:150920741
2357+a, gdbSNP:375263578
2367+c, tdbSNP:143081574
2401+c, gdbSNP:369736388
2403+a, gdbSNP:111613748
2404+c, tdbSNP:121913049
2407..2408+, cttacacttcacttccccagactacggadbSNP:397509401
2436+a, gdbSNP:2020960
2445+a, gdbSNP:373510515
2472+a, gdbSNP:2020953
2484+a, gdbSNP:200818432
2486+c, tdbSNP:141790888
2505+a, gdbSNP:147083262
2509+g, tdbSNP:138583819
2513+a, cdbSNP:370258803
2514+c, tdbSNP:1799801
2523+c, tdbSNP:200069811
2526+c, tdbSNP:200715555
2543+a, gdbSNP:377562755
2554+c, gdbSNP:374186605
2580+a, gdbSNP:111787810
2588+a, cdbSNP:4986933
2589+a, cdbSNP:76446924
2594+a, cdbSNP:202159590
2612+a, cdbSNP:368064765
2613+c, tdbSNP:370809250
2626+a, gdbSNP:2020957
2626+a, gdbSNP:386552867
2633+a, gdbSNP:1800124
2656+a, gdbSNP:201652412
2664+a, gdbSNP:16963255
2664+c, tdbSNP:386541532
2686+a, gdbSNP:201926295
2703+c, tdbSNP:138296474
2709+c, tdbSNP:191674905
2733+c, tdbSNP:3136225
2734+a, gdbSNP:140726146
2743+a, gdbSNP:150077735
complement(2744)-g, adbSNP:2020956
2771+c, tdbSNP:9929524
2785+c, tdbSNP:369845118
2803+c, tdbSNP:200296085
2804+a, gdbSNP:3136226
2855+a, gdbSNP:117384292
3078+a, tdbSNP:147799208
3119+a, gdbSNP:183465897
3171+c, tdbSNP:141279442
3244+g, tdbSNP:3743538
3273+c, gdbSNP:371345833
3318+a, cdbSNP:376791839
3434+c, gdbSNP:1651204
3435+a, cdbSNP:1651203
3439+c, gdbSNP:116246143
3439+c, gdbSNP:386441463
complement(3461)-t, adbSNP:146955145
3486+c, gdbSNP:2276464
3570+a, gdbSNP:2276465
3642+c, gdbSNP:187039399
3651+a, gdbSNP:191634336
3690+c, tdbSNP:1055443
3692+a, gdbSNP:112574290
3701+a, cdbSNP:376982978
3707+c, tdbSNP:117293226
3731+c, gdbSNP:2276466
3770+a, gdbSNP:182347151
3786+c, gdbSNP:368797729
3816+a, gdbSNP:72781468
3901+a, gdbSNP:186586436
3967+g, tdbSNP:193289721
4016+c, gdbSNP:373479879
4046+a, gdbSNP:185626419
4048+a, gdbSNP:143188036
4053+a, gdbSNP:375218385
4104+, tdbSNP:34388983
4113+a, gdbSNP:77401662
4181+g, tdbSNP:76447723
4232+c, tdbSNP:112742002
4315+c, tdbSNP:190536009
4406+c, gdbSNP:372528374
4444+a, gdbSNP:148155845
4640+c, tdbSNP:112776898
4654+a, gdbSNP:192910261
4676+, cdbSNP:34866586
4696+a, gdbSNP:115472788
complement(4899)-c, adbSNP:140019040
4934+a, gdbSNP:9925509
4939+c, tdbSNP:111651288
5271+a, gdbSNP:184381372
5273+a, cdbSNP:11075223
5299+a, gdbSNP:115526695
5332+, cdbSNP:61422086
5336..5337+a, ccdbSNP:386789300
5337+a, cdbSNP:56012340
5347+a, tdbSNP:76963262
5348+a, gdbSNP:188840787
5403+, gdbSNP:373646296
5409+a, tdbSNP:376328949
5497+a, gdbSNP:142073142
5504+a, tdbSNP:12325236
5576+a, tdbSNP:146325817
5639+a, cdbSNP:181178937
5652+c, gdbSNP:376334296
5765+c, gdbSNP:115605700
5792+g, tdbSNP:4781562
5853+c, tdbSNP:183916977
5885+a, gdbSNP:115183774
5890+c, tdbSNP:189232031
5931+c, tdbSNP:180762894
5955+a, gdbSNP:4781563
5960+a, gdbSNP:8056393
5963+a, gdbSNP:114059834
6027+a, gdbSNP:187182207
6199+a, gdbSNP:192113185
6253+c, tdbSNP:79560972
6297+c, tdbSNP:113073720
6318+, tdbSNP:34103244
6360..6361+, adbSNP:34282104
6380+c, tdbSNP:117678596
6476+a, gdbSNP:370469183
6561+c, tdbSNP:113403633
6574+a, gdbSNP:181872627
6673+c, gdbSNP:112259692
6706+, tdbSNP:3837752
6713+, tdbSNP:397778750
Gene SymbolERCC4
Gene SynonymERCC11; FANCQ; RAD1; XPF
Chromosome16
Locus Map16p13.12
Title XPF protein levels determine sensitivity of malignant melanoma cells to oxaliplatin chemotherapy: suitability as a biomarker for patient selection .
Author Hatch SB, Swift LP, Caporali S, Carter R, Hill EJ, MacGregor TP, D'Atri S, Middleton MR, McHugh PJ and Sharma RA.
Journal Int. J. Cancer 134 (6), 1495-1503 (2014)
Title Inter-individual variation in nucleotide excision repair pathway is modulated by non-synonymous polymorphisms in ERCC4 and MBD4 genes .
Author Allione A, Guarrera S, Russo A, Ricceri F, Purohit R, Pagnani A, Rosa F, Polidoro S, Voglino F and Matullo G.
Journal Mutat. Res. 751-752, 49-54 (2013)
Title Polymorphisms in the ERCC1 and XPF genes and risk of breast cancer in a Chinese population .
Author Yang Z, Fang X, Pei X and Li H.
Journal Genet Test Mol Biomarkers 17 (9), 700-706 (2013)
Title Xeroderma pigmentosum complementation group f polymorphisms influence risk of glioma .
Author Cheng HB, Xie C, Zhang RY, Hu SS, Wang Z and Yue W.
Journal Asian Pac. J. Cancer Prev. 14 (7), 4083-4087 (2013)
Title Effect of Xeroderma pigmentosum complementation group F polymorphisms on gastric cancer risk and associations with H.pylori infection .
Author Zhang JS, Zhang C, Yan XY, Yuan ZF, Duan ZY and Gao H.
Journal Asian Pac. J. Cancer Prev. 14 (3), 1847-1850 (2013)
Title Xeroderma pigmentosum group F caused by a defect in a structure-specific DNA repair endonuclease .
Author Sijbers AM, de Laat WL, Ariza RR, Biggerstaff M, Wei YF, Moggs JG, Carter KC, Shell BK, Evans E, de Jong MC, Rademakers S, de Rooij J, Jaspers NG, Hoeijmakers JH and Wood RD.
Journal Cell 86 (5), 811-822 (1996)
Title Purification and characterization of the XPF-ERCC1 complex of human .
Author Park CH, Bessho T, Matsunaga T and Sancar A.
Journal J. Biol. Chem. 270 (39), 22657-22660 (1995)
Title Formation of a ternary complex by human XPA, ERCC1, and ERCC4(XPF) excision repair proteins .
Author Park CH and Sancar A.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (11), 5017-5021 (1994)
Title Regional mapping of human DNA excision repair gene ERCC4 to chromosome 16p13.13-p13.2 .
Author Liu P, Siciliano J, White B, Legerski R, Callen D, Reeders S, Siciliano MJ and Thompson LH.
Journal Mutagenesis 8 (3), 199-205 (1993)
Title Xeroderma Pigmentosum .
Author Kraemer,K.H. and DiGiovanna,J.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.