• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 4 (ERCC4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005236 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 4 (ERCC4), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_005236.2, 164518896
Length 6765 bp
Structure linear
Update Date 25-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 4 (ERCC4), mRNA.
Product DNA repair endonuclease XPF
Comment

Summary: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause of xeroderma pigmentosum complementation group F (XP-F), or xeroderma pigmentosum VI (XP6).[provided by RefSeq, Mar 2009].

RefSeq NP_005227.1
CDS 10..2760
Misc Feature(1)298..2730
Misc Feature(2)298..2730
Misc Feature(3)706..771
Misc Feature(4)817..903
Misc Feature(5)874..876
Misc Feature(6)1465..1482
Misc Feature(7)1567..1569
Misc Feature(8)1570..1572
Misc Feature(9)1579..1581
Misc Feature(10)1858..2757
Misc Feature(11)2059..2292
Exon (1)1..216
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (2)217..397
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (3)398..593
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (4)594..801
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (5)802..982
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (6)983..1111
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (7)1112..1222
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (8)1223..1820
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (9)1821..1913
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (10)1914..2026
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Exon (11)2027..6761
Gene:ERCC4
Gene Synonym:ERCC11; FANCQ; RAD1; XPF
Translation MESGQPARRIAMAPLLEYERQLVLELLDTDGLVVCARGLGADRLLYHFLQLHCHPACLVL VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSNSRYEVYTQGGVIFATSRILVVDFLT DRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPTMLAIQTAILDILNACLKEL KCHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ YDCVTFLNLLESLRATEKAFGQNSGWLFLDSSTSMFINARARVYHLPDAKMSKKEKISEK MEIKEGEETKKELVLESNPKWEALTEVLKEIEAENKESEALGGPGQVLICASDDRTCSQL RDYITLGAEAFLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST KERTLKKKKRKLTLTQMVGKPEELEEEGDVEEGYRREISSSPESCPEEIKHEEFDVNLSS DAAFGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRPG KPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGT ASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTP EMCVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPSKPFSLTSRGALFQEIS SNDISSKLTLLTLHFPRLRILWCPSPHATAELFEELKQSKPQPDAATALAITADSETLPE SEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDF IHTSFAEVVSKGKGKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17+c, tdbSNP:148904556
25+c, tdbSNP:61760160
42+c, tdbSNP:3136042
48+a, gdbSNP:112419956
52+c, tdbSNP:140734311
78+a, gdbSNP:201606798
106+c, gdbSNP:34205098
109+c, gdbSNP:61731714
118+c, tdbSNP:144602005
220+dbSNP:
220+c, tdbSNP:145315496
226+a, gdbSNP:141591400
234+a, gdbSNP:192488568
237+a, gdbSNP:61760162
250+a, g, tdbSNP:55761944
261+c, tdbSNP:3136056
266+a, gdbSNP:187435008
268+c, tdbSNP:191886782
314+a, cdbSNP:144408815
334+a, gdbSNP:148791570
360+c, tdbSNP:189742296
376+a, gdbSNP:144666685
429+dbSNP:
429+c, tdbSNP:138724289
435+a, tdbSNP:147455220
456+g, tdbSNP:139989614
457+a, cdbSNP:145402255
467+c, gdbSNP:121913050
480+a, gdbSNP:3136092
484+c, gdbSNP:181993439
512+c, g, tdbSNP:2020961
541+g, tdbSNP:149927607
564+c, tdbSNP:113129434
661+dbSNP:
661+a, gdbSNP:145138851
712+a, gdbSNP:141101671
737+a, gdbSNP:144608823
739+a, cdbSNP:201176880
747+a, gdbSNP:146650135
785+a, gdbSNP:140299888
809+dbSNP:
809+g, tdbSNP:143479220
855+a, gdbSNP:200536315
884+a, gdbSNP:202243691
915+c, tdbSNP:148003381
932+a, tdbSNP:141961015
943+g, tdbSNP:200596978
947+c, tdbSNP:150244523
975..976+, tdbSNP:35090754
1040+dbSNP:
1040+a, tdbSNP:145851520
1054+a, gdbSNP:201410515
1073..1074+, adbSNP:34607888
1111+a, gdbSNP:148933357
1144+dbSNP:
1144+c, tdbSNP:1799802
1156+a, gdbSNP:201051665
1171+c, tdbSNP:199505105
1210+c, tdbSNP:147458778
1213+a, gdbSNP:200759609
1253+dbSNP:
1253+a, gdbSNP:1800067
1275+a, cdbSNP:181278137
1277+a, gdbSNP:143924094
1278+c, tdbSNP:144305111
1293+a, gdbSNP:3136151
1306+c, tdbSNP:116615540
1375+a, gdbSNP:142332295
1385+a, cdbSNP:201179693
1438+c, tdbSNP:41557814
1440+g, tdbSNP:139973061
1455+a, gdbSNP:114077770
1478..1479+, gdbSNP:34930410
1497+a, tdbSNP:146601373
1501+g, tdbSNP:140252818
1540+a, gdbSNP:200617058
1550+a, gdbSNP:201514032
1558+a, gdbSNP:150291286
1572+c, gdbSNP:41552412
1586+c, tdbSNP:149056863
1590+a, tdbSNP:200649435
1615+c, gdbSNP:143347563
1657+c, tdbSNP:139197943
1693+a, gdbSNP:55736359
1736+c, gdbSNP:1800068
1741+a, gdbSNP:202186213
1774+c, tdbSNP:147105770
1811+a, cdbSNP:138532294
1826+dbSNP:
1826+a, tdbSNP:189463122
1830+g, tdbSNP:61760161
1880+a, gdbSNP:180919656
1893+a, gdbSNP:2020958
1949+dbSNP:
1949+a, gdbSNP:112490976
1993+c, tdbSNP:2020955
2009+a, cdbSNP:200317919
2017+c, tdbSNP:139782718
2018+a, gdbSNP:56129764
2021+a, gdbSNP:201675333
2074+a, cdbSNP:149364215
2114+a, gdbSNP:144058769
2126+c, tdbSNP:1800069
2178+a, cdbSNP:2020959
2242+g, tdbSNP:12932917
2249+c, tdbSNP:12928616
2270+a, gdbSNP:143357336
2275+a, gdbSNP:201501958
2299+a, gdbSNP:146764714
2301+c, tdbSNP:139406689
2305+a, cdbSNP:142532415
2312+c, tdbSNP:12928650
2323+c, tdbSNP:150920741
2367+c, tdbSNP:143081574
2403+a, gdbSNP:111613748
2404+c, tdbSNP:121913049
2436+a, gdbSNP:2020960
2472+a, gdbSNP:2020953
2484+a, gdbSNP:200818432
2486+c, tdbSNP:141790888
2505+a, gdbSNP:147083262
2509+g, tdbSNP:138583819
2514+c, tdbSNP:1799801
2523+c, tdbSNP:200069811
2526+c, tdbSNP:200715555
2580+a, gdbSNP:111787810
2588+a, cdbSNP:4986933
2589+a, cdbSNP:76446924
2594+a, cdbSNP:202159590
2626+a, gdbSNP:2020957
2633+a, gdbSNP:1800124
2656+a, gdbSNP:201652412
2664+a, gdbSNP:16963255
2686+a, gdbSNP:201926295
2703+c, tdbSNP:138296474
2709+c, tdbSNP:191674905
2733+c, tdbSNP:3136225
2734+a, gdbSNP:140726146
2743+a, gdbSNP:150077735
2744+a, gdbSNP:2020956
2771+c, tdbSNP:9929524
2803+c, tdbSNP:200296085
2804+a, gdbSNP:3136226
2855+a, gdbSNP:117384292
3078+a, tdbSNP:147799208
3119+a, gdbSNP:183465897
3171+c, tdbSNP:141279442
3244+g, tdbSNP:3743538
3434+c, gdbSNP:1651204
3435+a, cdbSNP:1651203
3439+c, gdbSNP:116246143
3461+a, tdbSNP:146955145
3486+c, gdbSNP:2276464
3570+a, gdbSNP:2276465
3642+c, gdbSNP:187039399
3651+a, gdbSNP:191634336
3690+c, tdbSNP:1055443
3692+a, gdbSNP:112574290
3707+c, tdbSNP:117293226
3731+c, gdbSNP:2276466
3770+a, gdbSNP:182347151
3816+a, gdbSNP:72781468
3901+a, gdbSNP:186586436
3967+g, tdbSNP:193289721
4046+a, gdbSNP:185626419
4048+a, gdbSNP:143188036
4100+, tdbSNP:34388983
4113+a, gdbSNP:77401662
4181+g, tdbSNP:76447723
4232+c, tdbSNP:112742002
4315+c, tdbSNP:190536009
4444+a, gdbSNP:148155845
4640+c, tdbSNP:112776898
4654+a, gdbSNP:192910261
4676+, cdbSNP:34866586
4696+a, gdbSNP:115472788
4899+a, cdbSNP:140019040
4934+a, gdbSNP:9925509
4939+c, tdbSNP:111651288
5271+a, gdbSNP:184381372
5273+a, cdbSNP:11075223
5299+a, gdbSNP:115526695
5332+, cdbSNP:61422086
5337+a, cdbSNP:56012340
5347+a, tdbSNP:76963262
5348+a, gdbSNP:188840787
5497+a, gdbSNP:142073142
5504+a, tdbSNP:12325236
5576+a, tdbSNP:146325817
5639+a, cdbSNP:181178937
5765+c, gdbSNP:115605700
5792+g, tdbSNP:4781562
5853+c, tdbSNP:183916977
5885+a, gdbSNP:115183774
5890+c, tdbSNP:189232031
5931+c, tdbSNP:180762894
5955+a, gdbSNP:4781563
5960+a, gdbSNP:8056393
5963+a, gdbSNP:114059834
6027+a, gdbSNP:187182207
6199+a, gdbSNP:192113185
6253+c, tdbSNP:79560972
6297+c, tdbSNP:113073720
6313+, tdbSNP:34103244
6359..6360+, adbSNP:34282104
6380+c, tdbSNP:117678596
6561+c, tdbSNP:113403633
6574+a, gdbSNP:181872627
6673+c, gdbSNP:112259692
6706+, tdbSNP:3837752
Gene SymbolERCC4
Gene SynonymERCC11; FANCQ; RAD1; XPF
Chromosome16
Locus Map16p13.12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005236 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 4 (ERCC4), mRNA. On-demand $899.00 20
Title Comparison of ERCC1/XPF genetic variation, mRNA and protein levels in women with advanced stage ovarian cancer treated with intraperitoneal platinum .
Author Deloia,J.A., Bhagwat,N.R., Darcy,K.M., Strange,M., Tian,C., Nuttall,K., Krivak,T.C. and Niedernhofer,L.J.
Journal Gynecol. Oncol. 126 (3), 448-454 (2012)
Title XPG and XPF endonucleases trigger chromatin looping and DNA demethylation for accurate expression of activated genes .
Author Le May,N., Fradin,D., Iltis,I., Bougneres,P. and Egly,J.M.
Journal Mol. Cell 47 (4), 622-632 (2012)
Title Multiple DNA binding domains mediate the function of the ERCC1-XPF protein in nucleotide excision repair .
Author Su,Y., Orelli,B., Madireddy,A., Niedernhofer,L.J. and Scharer,O.D.
Journal J. Biol. Chem. 287 (26), 21846-21855 (2012)
Title Association between single nucleotide polymorphisms in ERCC4 and risk of squamous cell carcinoma of the head and neck .
Author Yu,H., Liu,Z., Huang,Y.J., Yin,M., Wang,L.E. and Wei,Q.
Journal PLoS ONE 7 (7), E41853 (2012)
Title Association between XPF polymorphisms and cancer risk: a meta-analysis .
Author Shi,T.Y., He,J., Qiu,L.X., Zhu,M.L., Wang,M.Y., Zhou,X.Y., Han,J., Yu,H., Zang,R.Y. and Wei,Q.
Journal PLoS ONE 7 (7), E38606 (2012)
Title ERCC4 (XPF) encodes a human nucleotide excision repair protein with eukaryotic recombination homologs .
Author Brookman,K.W., Lamerdin,J.E., Thelen,M.P., Hwang,M., Reardon,J.T., Sancar,A., Zhou,Z.Q., Walter,C.A., Parris,C.N. and Thompson,L.H.
Journal Mol. Cell. Biol. 16 (11), 6553-6562 (1996)
Title Xeroderma pigmentosum group F caused by a defect in a structure-specific DNA repair endonuclease .
Author Sijbers,A.M., de Laat,W.L., Ariza,R.R., Biggerstaff,M., Wei,Y.F., Moggs,J.G., Carter,K.C., Shell,B.K., Evans,E., de Jong,M.C., Rademakers,S., de Rooij,J., Jaspers,N.G., Hoeijmakers,J.H. and Wood,R.D.
Journal Cell 86 (5), 811-822 (1996)
Title Purification and characterization of the XPF-ERCC1 complex of human .
Author Park,C.H., Bessho,T., Matsunaga,T. and Sancar,A.
Journal J. Biol. Chem. 270 (39), 22657-22660 (1995)
Title Formation of a ternary complex by human XPA, ERCC1, and ERCC4(XPF) excision repair proteins .
Author Park,C.H. and Sancar,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (11), 5017-5021 (1994)
Title Regional mapping of human DNA excision repair gene ERCC4 to chromosome 16p13.13-p13.2 .
Author Liu,P., Siciliano,J., White,B., Legerski,R., Callen,D., Reeders,S., Siciliano,M.J. and Thompson,L.H.
Journal Mutagenesis 8 (3), 199-205 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.