• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005243 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_005243.3, 253970497
Length 2679 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2, mRNA.
Product RNA-binding protein EWS isoform 2
Comment

Summary: This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009].


Transcript Variant: This variant (2) lacks an alternate in-frame exon and uses an alternate in-frame splice site in the coding region, compared to variant 1. The resulting isoform (2) is shorter than isoform 1.

RefSeq NP_005234.1
CDS 329..2299
Misc Feature(1)302..304
Misc Feature(2)329..1183
Misc Feature(3)329..1183
Misc Feature(4)350..1183
Misc Feature(5)1121..1123
Misc Feature(6)1124..1126
Misc Feature(7)1226..1228
Misc Feature(8)1226..1228
Misc Feature(9)1232..1234
Misc Feature(10)1232..1234
Misc Feature(11)1238..1240
Misc Feature(12)1238..1240
Misc Feature(13)1253..1255
Misc Feature(14)1253..1255
Misc Feature(15)1268..1270
Misc Feature(16)1268..1270
Misc Feature(17)1277..1279
Misc Feature(18)1277..1279
Misc Feature(19)1289..1291
Misc Feature(20)1289..1291
Misc Feature(21)1370..1375
Misc Feature(22)<1400..>1678
Misc Feature(23)1400..1402
Misc Feature(24)1415..1660
Misc Feature(25)order(1418..1420,1562..1564,1568..1570)
Misc Feature(26)1652..1660
Misc Feature(27)1691..1693
Misc Feature(28)1718..1720
Misc Feature(29)1739..1741
Misc Feature(30)1739..1741
Misc Feature(31)1796..1798
Misc Feature(32)1796..1798
Misc Feature(33)1808..1810
Misc Feature(34)1808..1810
Misc Feature(35)1826..1828
Misc Feature(36)1826..1828
Misc Feature(37)1835..1837
Misc Feature(38)1835..1837
Misc Feature(39)1844..1846
Misc Feature(40)1844..1846
Misc Feature(41)1883..1972
Misc Feature(42)2015..2017
Misc Feature(43)2015..2017
Misc Feature(44)2021..2023
Misc Feature(45)2021..2023
Misc Feature(46)2042..2044
Misc Feature(47)2042..2044
Misc Feature(48)2051..2053
Misc Feature(49)2051..2053
Misc Feature(50)2069..2071
Misc Feature(51)2069..2071
Misc Feature(52)2093..2095
Misc Feature(53)2093..2095
Misc Feature(54)2102..2104
Misc Feature(55)2102..2104
Misc Feature(56)2114..2116
Misc Feature(57)2114..2116
Misc Feature(58)2126..2128
Misc Feature(59)2126..2128
Misc Feature(60)2135..2137
Misc Feature(61)2135..2137
Misc Feature(62)2147..2149
Misc Feature(63)2147..2149
Misc Feature(64)2171..2173
Misc Feature(65)2171..2173
Misc Feature(66)2225..2227
Misc Feature(67)2225..2227
Misc Feature(68)2234..2236
Misc Feature(69)2234..2236
Misc Feature(70)2243..2296
Exon (1)1..341
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (2)342..378
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (3)379..430
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (4)431..554
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (5)555..741
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (6)742..909
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (7)910..1121
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (8)1122..1302
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (9)1303..1340
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (10)1341..1373
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (11)1374..1492
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (12)1493..1622
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (13)1623..1745
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (14)1746..1908
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (15)1909..2006
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (16)2007..2259
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Exon (17)2260..2663
Gene:EWSR1
Gene Synonym:bK984G1.4; EWS
Translation MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
28+dbSNP:
28+c, tdbSNP:139842640
37+a, cdbSNP:184073673
57+a, gdbSNP:113274927
83+c, gdbSNP:188799962
123+c, gdbSNP:180730916
124+a, gdbSNP:116729446
189+a, tdbSNP:143153949
284+c, tdbSNP:111892587
304+a, gdbSNP:199589576
310+c, gdbSNP:201886504
326+c, tdbSNP:2231392
340+a, gdbSNP:147203739
352+dbSNP:
352+c, tdbSNP:201792944
355+c, tdbSNP:140505486
433+dbSNP:
433+a, cdbSNP:141206174
496+c, gdbSNP:150734586
529+a, gdbSNP:139048680
572+dbSNP:
572+a, gdbSNP:182195687
575+a, cdbSNP:4823027
720+a, cdbSNP:200282253
737+a, gdbSNP:149885670
757+dbSNP:
757+c, gdbSNP:200637771
763+c, tdbSNP:146418156
777+a, gdbSNP:113613489
808+a, gdbSNP:17850721
897+a, tdbSNP:139780199
898+c, tdbSNP:200828715
917+dbSNP:
917+a, tdbSNP:144503053
928+a, gdbSNP:146607451
976+a, gdbSNP:149180222
1033+a, gdbSNP:180973800
1043+a, gdbSNP:113912958
1096+a, gdbSNP:187368856
1186+dbSNP:
1186+c, tdbSNP:143296563
1203+a, gdbSNP:201795443
1290+c, gdbSNP:71329463
1308+dbSNP:
1308+a, cdbSNP:151266236
1329+a, gdbSNP:201549256
1504+dbSNP:
1504+a, gdbSNP:189488022
1592+a, gdbSNP:200360700
1604+g, tdbSNP:140488021
1665+dbSNP:
1665+a, gdbSNP:200670756
1679+a, gdbSNP:201802087
1721+a, gdbSNP:41311143
1739+c, tdbSNP:138287627
1778+dbSNP:
1778+a, gdbSNP:143781060
1797+a, gdbSNP:146069416
1926+dbSNP:
1926+a, gdbSNP:201950459
1930+c, tdbSNP:138837921
1986+c, tdbSNP:149288880
1987+a, gdbSNP:144536392
2015+dbSNP:
2015+c, tdbSNP:199957418
2080+c, tdbSNP:148438243
2155+c, tdbSNP:182236482
2172+a, gdbSNP:201365388
2179+c, g, tdbSNP:111270799
2207+g, tdbSNP:202103106
2211+a, cdbSNP:200316952
2261+dbSNP:
2261+a, gdbSNP:145953477
2301+a, tdbSNP:139786904
2313+a, gdbSNP:200423555
2395+a, cdbSNP:3205130
2428+c, gdbSNP:728760
2494+a, gdbSNP:11545666
2524+c, tdbSNP:149241548
2542+c, tdbSNP:193121445
2586+c, tdbSNP:1055852
2617..2619+, tttdbSNP:76631619
Gene SymbolEWSR1
Gene SynonymbK984G1.4; EWS
Chromosome22
Locus Map22q12.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001163285 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 3, mRNA. On-demand $849.00 20
NM_001163286 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 4, mRNA. On-demand $849.00 20
NM_001163287 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 5, mRNA. In-stock $418.00 $369.00 10
NM_005243 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2, mRNA. In-stock $639.00 $590.00 15
NM_013986 Homo sapiens Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 1, mRNA. On-demand $849.00 20
Title Ewing's sarcoma: analysis of single nucleotide polymorphism in the .
Author Silva,D.S., Sawitzki,F.R., De Toni,E.C., Graebin,P., Picanco,J.B., Abujamra,A.L., de Farias,C.B., Roesler,R., Brunetto,A.L. and Alho,C.S.
Journal Gene 509 (2), 263-266 (2012)
Title Accumulation of pre-let-7g and downregulation of mature let-7g with the depletion of EWS .
Author Sohn,E.J., Park,J., Kang,S.I. and Wu,Y.P.
Journal Biochem. Biophys. Res. Commun. 426 (1), 89-93 (2012)
Title Targeting the EWSR1-FLI1 oncogene-induced protein kinase PKC-beta abolishes ewing sarcoma growth .
Author Surdez,D., Benetkiewicz,M., Perrin,V., Han,Z.Y., Pierron,G., Ballet,S., Lamoureux,F., Redini,F., Decouvelaere,A.V., Daudigeos-Dubus,E., Geoerger,B., de Pinieux,G., Delattre,O. and Tirode,F.
Journal Cancer Res. 72 (17), 4494-4503 (2012)
Title Gene expression responses to FUS, EWS, and TAF15 reduction and stress granule sequestration analyses identifies FET-protein non-redundant functions .
Author Blechingberg,J., Luo,Y., Bolund,L., Damgaard,C.K. and Nielsen,A.L.
Journal PLoS ONE 7 (9), E46251 (2012)
Title Identification and characterization of the nuclear localization/retention signal in the EWS proto-oncoprotein .
Author Zakaryan,R.P. and Gehring,H.
Journal J. Mol. Biol. 363 (1), 27-38 (2006)
Title Molecular analysis of a t(11;22) translocation junction in a case of Ewing's sarcoma .
Author Bhagirath,T., Abe,S., Nojima,T. and Yoshida,M.C.
Journal Genes Chromosomes Cancer 13 (2), 126-132 (1995)
Title The EWS gene, involved in Ewing family of tumors, malignant melanoma of soft parts and desmoplastic small round cell tumors, codes for an RNA binding protein with novel regulatory domains .
Author Ohno,T., Ouchida,M., Lee,L., Gatalica,Z., Rao,V.N. and Reddy,E.S.
Journal Oncogene 9 (10), 3087-3097 (1994)
Title Genomic structure of the EWS gene and its relationship to EWSR1, a site of tumor-associated chromosome translocation .
Author Plougastel,B., Zucman,J., Peter,M., Thomas,G. and Delattre,O.
Journal Genomics 18 (3), 609-615 (1993)
Title EWS and ATF-1 gene fusion induced by t(12;22) translocation in malignant melanoma of soft parts .
Author Zucman,J., Delattre,O., Desmaze,C., Epstein,A.L., Stenman,G., Speleman,F., Fletchers,C.D., Aurias,A. and Thomas,G.
Journal Nat. Genet. 4 (4), 341-345 (1993)
Title Gene fusion with an ETS DNA-binding domain caused by chromosome translocation in human tumours .
Author Delattre,O., Zucman,J., Plougastel,B., Desmaze,C., Melot,T., Peter,M., Kovar,H., Joubert,I., de Jong,P., Rouleau,G. et al.
Journal Nature 359 (6391), 162-165 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.