• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor 3 (FGF3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18680 Homo sapiens fibroblast growth factor 3 (FGF3), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu18680C Homo sapiens fibroblast growth factor 3 (FGF3), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005247.2, 15451899
Length 720 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor 3 (FGF3), mRNA.
Product fibroblast growth factor 3 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation. [provided by RefSeq, Jul 2008].

RefSeq NP_005238.1
CDS 492..1211
Misc Feature(1)627..1034
Misc Feature(2)order(627..629,636..638,726..728,732..734,738..740,
Misc Feature(3)order(963..968,981..983,993..995,1011..1013)
Exon (1)1..711
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Exon (2)712..815
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Exon (3)816..1548
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Translation MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(233)-dbSNP:
complement(233)-g, cdbSNP:41408348
complement(318)-g, cdbSNP:12418223
complement(368)-c, adbSNP:143969364
508+c, tdbSNP:121917706
complement(560)-c, adbSNP:41538178
637+a, gdbSNP:281860300
641+a, cdbSNP:281860301
687+g, tdbSNP:121917705
complement(728)-dbSNP:
complement(728)-t, cdbSNP:376992420
complement(736)-t, cdbSNP:146864055
complement(742..743)-, cdbSNP:142716324
746+, tdbSNP:281860302
complement(770)-g, adbSNP:139633006
774+c, tdbSNP:281860303
complement(794)-g, cdbSNP:61623544
801+c, tdbSNP:121917704
complement(802)-c, adbSNP:150581924
808+a, gdbSNP:281860306
complement(814)-g, adbSNP:143593259
complement(815)-g, cdbSNP:369001003
complement(827)-dbSNP:
complement(827)-g, adbSNP:148729466
complement(831)-g, cdbSNP:147952743
complement(836)-g, adbSNP:116162988
complement(837)-t, cdbSNP:79472069
complement(849)-g, adbSNP:376445217
complement(853)-t, adbSNP:144384566
885+, cdbSNP:281860304
complement(885)-g, adbSNP:372402801
complement(889)-t, adbSNP:149649414
complement(895)-t, cdbSNP:199801193
complement(899)-t, cdbSNP:35420992
complement(900)-c, adbSNP:147515396
complement(911)-t, cdbSNP:370444194
complement(939)-t, cdbSNP:200088042
948..949+, tgdbSNP:281860307
complement(954)-t, cdbSNP:143483033
957+c, tdbSNP:121917703
complement(966)-t, cdbSNP:138021053
complement(971)-t, cdbSNP:146918153
complement(989)-g, adbSNP:373420417
complement(1003)-t, cdbSNP:35983315
1009+a, tdbSNP:7110221
complement(1045)-t, gdbSNP:143175848
complement(1055)-g, adbSNP:113473565
complement(1061)-t, cdbSNP:369547972
complement(1076)-c, adbSNP:115545058
complement(1100)-g, adbSNP:376589860
1107+, gdbSNP:281860305
complement(1116)-g, adbSNP:374453035
complement(1119)-g, adbSNP:369755339
complement(1120)-t, cdbSNP:115452181
complement(1126)-c, adbSNP:377265856
complement(1127)-t, cdbSNP:371531315
complement(1139)-g, adbSNP:367789711
complement(1163)-g, adbSNP:375708730
complement(1230)-t, cdbSNP:375218049
complement(1399)-t, cdbSNP:372835674
complement(1471)-t, cdbSNP:117217211
complement(1539)-g, adbSNP:370529528
Gene SymbolFGF3
Gene SynonymHBGF-3; INT2
Chromosome11
Locus Map11q13
Title Increased FGF3 and FGF4 gene dosage is a risk factor for craniosynostosis .
Author Grillo L, Greco D, Pettinato R, Avola E, Potenza N, Castiglia L, Spalletta A, Amata S, Di Benedetto D, Luciano D, Romano C and Fichera M.
Journal Gene 534 (2), 435-439 (2014)
Title Tooth agenesis association with self-reported family history of cancer .
Author Kuchler EC, Lips A, Tannure PN, Ho B, Costa MC, Granjeiro JM and Vieira AR.
Journal J. Dent. Res. 92 (2), 149-155 (2013)
Title Elevated FGF 23 and phosphorus are associated with coronary calcification in hemodialysis patients .
Author Srivaths PR, Goldstein SL, Silverstein DM, Krishnamurthy R and Brewer ED.
Journal Pediatr. Nephrol. 26 (6), 945-951 (2011)
Title LAMM syndrome with middle ear dysplasia associated with compound heterozygosity for FGF3 mutations .
Author Sensi A, Ceruti S, Trevisi P, Gualandi F, Busi M, Donati I, Neri M, Ferlini A and Martini A.
Journal Am. J. Med. Genet. A 155A (5), 1096-1101 (2011)
Title Variable expressivity of FGF3 mutations associated with deafness and LAMM syndrome .
Author Riazuddin S, Ahmed ZM, Hegde RS, Khan SN, Nasir I, Shaukat U, Riazuddin S, Butman JA, Griffith AJ, Friedman TB and Choi BY.
Journal BMC Med. Genet. 12, 21 (2011)
Title Mice homozygous for a targeted disruption of the proto-oncogene int-2 have developmental defects in the tail and inner ear .
Author Mansour SL, Goddard JM and Capecchi MR.
Journal Development 117 (1), 13-28 (1993)
Title Congenital Deafness with Labyrinthine Aplasia, Microtia, and Microdontia .
Author Ordonez,J. and Tekin,M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title The int-2 proto-oncogene is responsible for induction of the inner ear .
Author Represa J, Leon Y, Miner C and Giraldez F.
Journal Nature 353 (6344), 561-563 (1991)
Title Sequence organization of the human int-2 gene and its expression in teratocarcinoma cells .
Author Brookes S, Smith R, Casey G, Dickson C and Peters G.
Journal Oncogene 4 (4), 429-436 (1989)
Title Characterization and chromosome assignment of the human homolog of int-2, a potential proto-oncogene .
Author Casey,G., Smith,R., McGillivray,D., Peters,G. and Dickson,C.
Journal Mol. Cell. Biol. 6 (2), 502-510 (1986)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.