• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor 3 (FGF3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005247 Homo sapiens fibroblast growth factor 3 (FGF3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_005247.2, 15451899
Length 1548 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor 3 (FGF3), mRNA.
Product fibroblast growth factor 3 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation. [provided by RefSeq, Jul 2008].

RefSeq NP_005238.1
CDS 492..1211
Misc Feature(1)627..1034
Misc Feature(2)order(627..629,636..638,726..728,732..734,738..740,
Misc Feature(3)order(963..968,981..983,993..995,1011..1013)
Exon (1)1..711
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Exon (2)712..815
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Exon (3)816..1548
Gene:FGF3
Gene Synonym:HBGF-3; INT2
Translation MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(233)-dbSNP:
complement(233)-g, cdbSNP:41408348
complement(318)-g, cdbSNP:12418223
complement(368)-c, adbSNP:143969364
complement(508)-t, cdbSNP:121917706
complement(560)-c, adbSNP:41538178
complement(637)-g, adbSNP:281860300
complement(641)-c, adbSNP:281860301
complement(687)-t, gdbSNP:121917705
complement(736)-dbSNP:
complement(736)-t, cdbSNP:146864055
complement(742..743)-, cdbSNP:142716324
complement(746)-, tdbSNP:281860302
complement(770)-g, adbSNP:139633006
complement(774)-t, cdbSNP:281860303
complement(794)-g, cdbSNP:61623544
complement(801)-t, cdbSNP:121917704
complement(802)-c, adbSNP:150581924
complement(808)-g, adbSNP:281860306
complement(814)-g, adbSNP:143593259
complement(827)-dbSNP:
complement(827)-g, adbSNP:148729466
complement(831)-g, cdbSNP:147952743
complement(836)-g, adbSNP:116162988
complement(837)-t, cdbSNP:79472069
complement(853)-t, adbSNP:144384566
complement(885)-, cdbSNP:281860304
complement(889)-t, adbSNP:149649414
complement(895)-t, cdbSNP:199801193
complement(899)-t, cdbSNP:35420992
complement(900)-c, adbSNP:147515396
complement(939)-t, cdbSNP:200088042
complement(948..949)-, tgdbSNP:281860307
complement(954)-t, cdbSNP:143483033
complement(957)-t, cdbSNP:121917703
complement(966)-t, cdbSNP:138021053
complement(971)-t, cdbSNP:146918153
complement(1003)-t, cdbSNP:35983315
complement(1009)-t, adbSNP:7110221
complement(1033)-t, cdbSNP:148203315
complement(1045)-t, gdbSNP:143175848
complement(1055)-g, adbSNP:113473565
complement(1076)-c, adbSNP:115545058
complement(1107)-, gdbSNP:281860305
complement(1120)-t, cdbSNP:115452181
complement(1471)-t, cdbSNP:117217211
Gene SymbolFGF3
Gene SynonymHBGF-3; INT2
Chromosome11
Locus Map11q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005247 Homo sapiens fibroblast growth factor 3 (FGF3), mRNA. On-demand TBD TBD
Title Tooth agenesis association with self-reported family history of cancer .
Author Kuchler,E.C., Lips,A., Tannure,P.N., Ho,B., Costa,M.C., Granjeiro,J.M. and Vieira,A.R.
Journal J. Dent. Res. 92 (2), 149-155 (2013)
Title Elevated FGF 23 and phosphorus are associated with coronary calcification in hemodialysis patients .
Author Srivaths,P.R., Goldstein,S.L., Silverstein,D.M., Krishnamurthy,R. and Brewer,E.D.
Journal Pediatr. Nephrol. 26 (6), 945-951 (2011)
Title LAMM syndrome with middle ear dysplasia associated with compound heterozygosity for FGF3 mutations .
Author Sensi,A., Ceruti,S., Trevisi,P., Gualandi,F., Busi,M., Donati,I., Neri,M., Ferlini,A. and Martini,A.
Journal Am. J. Med. Genet. A 155A (5), 1096-1101 (2011)
Title Variable expressivity of FGF3 mutations associated with deafness and LAMM syndrome .
Author Riazuddin,S., Ahmed,Z.M., Hegde,R.S., Khan,S.N., Nasir,I., Shaukat,U., Riazuddin,S., Butman,J.A., Griffith,A.J., Friedman,T.B. and Choi,B.Y.
Journal BMC Med. Genet. 12, 21 (2011)
Title Genome-wide association study identifies five new breast cancer susceptibility loci .
Author Turnbull,C., Ahmed,S., Morrison,J., Pernet,D., Renwick,A., Maranian,M., Seal,S., Ghoussaini,M., Hines,S., Healey,C.S., Hughes,D., Warren-Perry,M., Tapper,W., Eccles,D., Evans,D.G., Hooning,M., Schutte,M., van den Ouweland,A., Houlston,R., Ross,G., Langford,C., Pharoah,P.D., Stratton,M.R., Dunning,A.M., Rahman,N. and Easton,D.F.
Journal Nat. Genet. 42 (6), 504-507 (2010)
Title Identification of six novel autophosphorylation sites on fibroblast growth factor receptor 1 and elucidation of their importance in receptor activation and signal transduction .
Author Mohammadi,M., Dikic,I., Sorokin,A., Burgess,W.H., Jaye,M. and Schlessinger,J.
Journal Mol. Cell. Biol. 16 (3), 977-989 (1996)
Title Mice homozygous for a targeted disruption of the proto-oncogene int-2 have developmental defects in the tail and inner ear .
Author Mansour,S.L., Goddard,J.M. and Capecchi,M.R.
Journal Development 117 (1), 13-28 (1993)
Title The int-2 proto-oncogene is responsible for induction of the inner ear .
Author Represa,J., Leon,Y., Miner,C. and Giraldez,F.
Journal Nature 353 (6344), 561-563 (1991)
Title Sequence organization of the human int-2 gene and its expression in teratocarcinoma cells .
Author Brookes,S., Smith,R., Casey,G., Dickson,C. and Peters,G.
Journal Oncogene 4 (4), 429-436 (1989)
Title Characterization and chromosome assignment of the human homolog of int-2, a potential proto-oncogene .
Author Casey,G., Smith,R., McGillivray,D., Peters,G. and Dickson,C.
Journal Mol. Cell. Biol. 6 (2), 502-510 (1986)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.