• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin G associated kinase (GAK), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005255 Homo sapiens cyclin G associated kinase (GAK), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_005255.2, 157384970
Length 4549 bp
Structure linear
Update Date 11-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin G associated kinase (GAK), transcript variant 1, mRNA.
Product cyclin-G-associated kinase isoform 1
Comment

Summary: In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_005246.2
CDS 200..4135
Misc Feature(1)125..127
Misc Feature(2)203..205
Misc Feature(3)203..205
Misc Feature(4)245..247
Misc Feature(5)320..1126
Misc Feature(6)320..1126
Misc Feature(7)order(335..349,359..361,398..400,404..406,494..496,
Misc Feature(8)order(335..349,359..361,398..400,404..406,494..496,
Misc Feature(9)order(347..349,584..586,590..592,716..718,722..724,
Misc Feature(10)order(767..787,866..874)
Misc Feature(11)1565..1567
Misc Feature(12)1907..2323
Misc Feature(13)2507..2509
Misc Feature(14)2591..>3061
Misc Feature(15)2675..2677
Misc Feature(16)2684..2686
Misc Feature(17)2699..2701
Misc Feature(18)3014..3016
Misc Feature(19)3485..3487
Misc Feature(20)3725..3727
Misc Feature(21)3752..3754
Misc Feature(22)<3977..4111
Misc Feature(23)order(4022..4030,4064..4066,4073..4078,4085..4090)
Exon (1)1..344
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (2)345..406
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (3)407..466
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (4)467..581
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (5)582..724
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (6)725..850
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (7)851..940
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (8)941..1076
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (9)1077..1189
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (10)1190..1280
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (11)1281..1404
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (12)1405..1454
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (13)1455..1603
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (14)1604..1726
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (15)1727..1860
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (16)1861..2055
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (17)2056..2173
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (18)2174..2253
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (19)2254..2447
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (20)2448..2594
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (21)2595..3071
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (22)3072..3242
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (23)3243..3365
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (24)3366..3482
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (25)3483..3707
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (26)3708..3856
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (27)3857..4033
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (28)4034..4531
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Translation MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-dbSNP:
complement(52)-t, cdbSNP:112514562
complement(71)-g, adbSNP:149820687
complement(125)-g, adbSNP:114747936
complement(148)-t, cdbSNP:372789649
complement(241)-t, cdbSNP:376971594
complement(275)-t, adbSNP:373555101
complement(294)-g, adbSNP:371061930
complement(420)-dbSNP:
complement(420)-t, cdbSNP:376467652
complement(427)-t, cdbSNP:147271443
complement(485)-dbSNP:
complement(485)-g, cdbSNP:144020930
complement(496)-g, adbSNP:139759111
complement(507)-g, adbSNP:200829743
complement(514)-t, cdbSNP:375145539
complement(517)-g, adbSNP:377322288
complement(518)-t, cdbSNP:138465573
complement(540)-g, adbSNP:150486451
complement(544)-t, cdbSNP:141559289
complement(556)-g, adbSNP:371874998
557+c, tdbSNP:1141284
complement(594)-dbSNP:
complement(594)-t, adbSNP:147981787
complement(622)-g, adbSNP:371836315
complement(670)-g, adbSNP:367654130
complement(671)-c, adbSNP:143423428
complement(673)-g, adbSNP:140230555
complement(690)-t, cdbSNP:146710139
complement(700)-t, cdbSNP:376265226
complement(703)-g, adbSNP:372747156
complement(713)-t, gdbSNP:368383726
complement(719)-t, gdbSNP:375697752
complement(720)-t, adbSNP:185238939
complement(791)-dbSNP:
complement(791)-t, cdbSNP:144655362
complement(796)-t, cdbSNP:141049049
complement(845)-t, cdbSNP:144983014
complement(853)-dbSNP:
complement(853)-t, gdbSNP:376555700
complement(901)-t, cdbSNP:144477169
complement(940)-t, cdbSNP:149963126
complement(975)-dbSNP:
complement(975)-t, cdbSNP:139175908
complement(976)-c, adbSNP:368323761
complement(988)-g, adbSNP:374973252
complement(991)-t, cdbSNP:151250837
complement(1008)-t, cdbSNP:144664799
complement(1027)-g, adbSNP:56058184
complement(1030)-t, cdbSNP:181152973
complement(1037)-g, c, adbSNP:200584785
complement(1039)-t, cdbSNP:116865703
complement(1040)-g, adbSNP:143895569
complement(1047)-g, adbSNP:200913305
complement(1054)-g, adbSNP:140104121
complement(1078)-dbSNP:
complement(1078)-g, adbSNP:202217789
complement(1079)-t, cdbSNP:372500341
complement(1123)-t, cdbSNP:144759809
complement(1147)-g, cdbSNP:374345324
complement(1149)-g, adbSNP:149432967
complement(1157)-g, adbSNP:368206833
complement(1158)-t, cdbSNP:371284475
complement(1162)-g, adbSNP:200910077
complement(1219)-dbSNP:
complement(1219)-g, adbSNP:369233298
complement(1233)-t, cdbSNP:376724505
complement(1237)-g, cdbSNP:144456621
complement(1249)-g, adbSNP:138971969
complement(1250)-t, cdbSNP:150270892
complement(1259)-t, cdbSNP:375396909
complement(1293)-dbSNP:
complement(1293)-g, adbSNP:41286657
complement(1308)-g, adbSNP:138522060
complement(1335)-g, cdbSNP:200248212
1396+c, tdbSNP:2279181
complement(1400)-t, cdbSNP:140876519
complement(1417)-dbSNP:
complement(1417)-g, adbSNP:111770118
complement(1420)-g, cdbSNP:372234424
complement(1436)-t, cdbSNP:11722461
complement(1469)-dbSNP:
complement(1469)-c, adbSNP:201737172
complement(1492)-g, adbSNP:143820789
complement(1499)-t, cdbSNP:371961764
complement(1505)-t, cdbSNP:200352055
complement(1515)-t, cdbSNP:144343843
complement(1522)-t, gdbSNP:369476372
complement(1532)-t, cdbSNP:375006351
complement(1552)-g, adbSNP:371610483
complement(1553)-t, cdbSNP:148874511
complement(1555)-t, gdbSNP:202112980
complement(1570)-t, cdbSNP:200172491
complement(1581)-t, cdbSNP:145652195
complement(1591)-c, adbSNP:144499981
complement(1594)-g, cdbSNP:140729096
complement(1599)-t, cdbSNP:147659460
complement(1609)-dbSNP:
complement(1609)-g, adbSNP:145448359
complement(1622)-t, cdbSNP:201272980
1656+a, gdbSNP:1802538
complement(1660)-g, adbSNP:372667052
complement(1663)-g, adbSNP:139283842
complement(1669)-t, cdbSNP:150848070
complement(1678)-g, adbSNP:142430163
complement(1679)-t, c, adbSNP:148765045
complement(1714)-g, adbSNP:146926083
complement(1715)-t, cdbSNP:377034417
complement(1739)-dbSNP:
complement(1739)-c, adbSNP:374987786
complement(1741)-t, cdbSNP:187249639
complement(1743..1744)-, tdbSNP:34366710
complement(1784)-c, adbSNP:367878380
complement(1801)-g, adbSNP:138537917
complement(1891)-dbSNP:
complement(1891)-c, adbSNP:75808664
complement(1927)-t, cdbSNP:192890169
complement(1936)-g, adbSNP:372096519
complement(1937)-t, cdbSNP:34255232
complement(1951)-g, adbSNP:142467531
complement(1952)-t, cdbSNP:375729595
complement(1957)-g, adbSNP:35964990
complement(1974)-t, cdbSNP:150317412
complement(1975)-g, cdbSNP:367787869
complement(1978)-g, adbSNP:140333372
1984+c, gdbSNP:76741426
complement(1996)-g, adbSNP:147683833
complement(2006)-t, cdbSNP:146207272
complement(2008)-g, cdbSNP:202134985
complement(2009)-g, cdbSNP:142221119
complement(2017)-t, cdbSNP:147669221
complement(2019)-t, cdbSNP:370708001
complement(2044)-g, adbSNP:367892342
complement(2083)-dbSNP:
complement(2083)-t, cdbSNP:373873427
complement(2084)-t, cdbSNP:183655284
complement(2096)-g, c, adbSNP:201465712
complement(2097)-t, cdbSNP:377332465
complement(2104)-t, cdbSNP:145385558
complement(2110)-t, cdbSNP:41286651
complement(2115)-t, adbSNP:372982739
complement(2126)-t, cdbSNP:145777066
2137+c, tdbSNP:41333249
complement(2147)-t, adbSNP:201736881
complement(2158)-g, adbSNP:369455263
complement(2160)-t, cdbSNP:199572880
complement(2226)-dbSNP:
complement(2226)-t, cdbSNP:139900404
complement(2266)-dbSNP:
complement(2266)-g, adbSNP:375332050
complement(2267)-t, cdbSNP:140022645
complement(2269)-t, cdbSNP:200009469
complement(2291)-g, adbSNP:200776520
complement(2293)-t, cdbSNP:146114266
complement(2326)-t, cdbSNP:377594780
complement(2346..2347)-, gdbSNP:34006401
complement(2349)-t, cdbSNP:199633903
complement(2350)-t, cdbSNP:144509628
complement(2357)-g, adbSNP:114856459
complement(2373)-g, adbSNP:146391123
complement(2414)-g, adbSNP:141655027
complement(2415)-t, cdbSNP:369492221
complement(2491)-dbSNP:
complement(2491)-g, adbSNP:144503542
complement(2508)-g, cdbSNP:375045923
complement(2511)-g, adbSNP:371596915
complement(2512)-t, cdbSNP:149263722
complement(2522)-g, cdbSNP:367897357
2535+a, gdbSNP:1056673
complement(2541)-g, adbSNP:373690913
complement(2551)-g, adbSNP:138831984
complement(2555)-t, cdbSNP:145911873
complement(2556)-g, adbSNP:201830875
complement(2557)-t, cdbSNP:79029749
complement(2558)-c, adbSNP:34585705
complement(2560)-g, adbSNP:112202640
complement(2567)-g, adbSNP:375149692
complement(2579)-t, cdbSNP:147004796
complement(2580)-g, adbSNP:371808360
complement(2581)-c, adbSNP:115244803
complement(2597)-dbSNP:
complement(2597)-t, cdbSNP:151239768
complement(2600)-t, cdbSNP:200947459
complement(2604..2605)-, cdbSNP:35072826
complement(2645)-t, cdbSNP:28640071
complement(2645)-g, adbSNP:386452335
complement(2672)-t, cdbSNP:149152501
complement(2687)-t, cdbSNP:201570829
complement(2702)-g, adbSNP:375746181
complement(2703)-g, adbSNP:199860840
complement(2704)-t, cdbSNP:368421826
complement(2713)-g, adbSNP:146609783
complement(2717)-t, cdbSNP:375665390
complement(2726)-g, cdbSNP:370884471
complement(2728)-g, adbSNP:144444649
complement(2734)-g, adbSNP:368064003
complement(2735)-t, cdbSNP:201361013
complement(2742)-t, adbSNP:373942194
complement(2750)-t, cdbSNP:199550885
complement(2765)-g, cdbSNP:139694554
complement(2777)-c, adbSNP:202089349
complement(2801)-g, cdbSNP:201584204
complement(2803)-t, cdbSNP:113722219
2817+a, cdbSNP:1141285
complement(2825)-g, adbSNP:373562468
complement(2829)-t, cdbSNP:149842313
complement(2843)-t, cdbSNP:139051032
complement(2863)-g, adbSNP:376010644
complement(2864)-t, cdbSNP:150706546
complement(2874)-g, adbSNP:372718341
complement(2880)-g, adbSNP:368428903
complement(2892)-g, adbSNP:201137296
complement(2924)-t, cdbSNP:200903151
complement(2957)-t, cdbSNP:201968587
complement(3019)-t, cdbSNP:112225848
complement(3026)-g, cdbSNP:368118041
complement(3047)-g, cdbSNP:140439488
complement(3065)-t, cdbSNP:147165061
complement(3068)-t, cdbSNP:143655919
complement(3079)-dbSNP:
complement(3079)-t, gdbSNP:201308050
complement(3087)-g, adbSNP:138100414
complement(3096)-g, adbSNP:143612464
complement(3097)-t, cdbSNP:149317198
complement(3098)-t, adbSNP:199713255
complement(3108)-t, cdbSNP:112990443
complement(3127)-g, adbSNP:267600280
complement(3145)-g, adbSNP:369273053
complement(3146)-t, cdbSNP:138724620
complement(3156)-t, cdbSNP:200252102
complement(3160)-t, cdbSNP:150182601
complement(3172)-g, adbSNP:201506389
complement(3175)-g, adbSNP:200268987
complement(3189)-g, adbSNP:200039965
complement(3190)-t, cdbSNP:147912680
3202+c, tdbSNP:1064207
complement(3218)-g, adbSNP:202016140
complement(3224)-t, cdbSNP:140672161
complement(3226)-g, adbSNP:146838470
complement(3227)-t, cdbSNP:376508571
complement(3237)-t, cdbSNP:201196228
complement(3259)-dbSNP:
complement(3259)-t, cdbSNP:142955360
complement(3296)-g, adbSNP:369296871
complement(3308)-t, gdbSNP:77455473
3334+a, gdbSNP:1026738
complement(3351)-g, adbSNP:35227944
complement(3352)-t, cdbSNP:149678181
complement(3361)-t, cdbSNP:376763304
complement(3373)-dbSNP:
complement(3373)-t, gdbSNP:199816854
complement(3388)-c, adbSNP:190420984
complement(3393)-g, adbSNP:199901666
complement(3394)-t, cdbSNP:140272764
complement(3400)-g, adbSNP:200909207
complement(3414)-g, adbSNP:200884438
complement(3417)-g, cdbSNP:147175932
complement(3418)-g, cdbSNP:201241614
complement(3432)-t, gdbSNP:143488954
complement(3438)-g, adbSNP:139690161
complement(3439)-t, cdbSNP:150760089
complement(3460)-g, adbSNP:141358912
complement(3466)-g, cdbSNP:374905719
complement(3472)-g, adbSNP:79742312
complement(3476)-g, adbSNP:373361686
complement(3505)-dbSNP:
complement(3505)-g, adbSNP:55697914
complement(3508)-c, adbSNP:142037003
complement(3525)-g, adbSNP:138890416
complement(3534)-g, adbSNP:371404744
complement(3537)-g, adbSNP:145713462
complement(3542)-t, cdbSNP:145100581
complement(3559)-g, cdbSNP:55801437
complement(3567)-t, cdbSNP:145818077
complement(3586)-g, cdbSNP:367691274
complement(3589)-t, gdbSNP:372104503
complement(3597)-g, adbSNP:150254936
complement(3606)-t, cdbSNP:374621415
complement(3609)-g, adbSNP:56169884
complement(3611)-g, adbSNP:141041086
complement(3615)-g, cdbSNP:151123471
complement(3652)-t, cdbSNP:377418158
complement(3667)-g, adbSNP:200146913
complement(3677)-g, cdbSNP:142966472
complement(3687)-c, adbSNP:141977918
complement(3700)-g, adbSNP:147555555
complement(3702)-t, cdbSNP:56326341
complement(3733)-dbSNP:
complement(3733)-g, adbSNP:369002990
complement(3746)-g, adbSNP:139521838
complement(3781)-g, cdbSNP:377387724
complement(3799)-g, adbSNP:75072999
complement(3804)-g, adbSNP:149731617
complement(3835)-g, adbSNP:139558681
complement(3852)-c, adbSNP:150598346
complement(3884)-dbSNP:
complement(3884)-g, adbSNP:142635741
complement(3885)-t, cdbSNP:375044978
complement(3931)-t, gdbSNP:138216547
complement(3948)-g, adbSNP:149742374
complement(3949)-t, cdbSNP:146290503
complement(3964)-g, adbSNP:141947839
3993+a, gdbSNP:2306242
complement(4004)-g, adbSNP:143277193
complement(4005)-t, cdbSNP:149200314
complement(4006)-g, adbSNP:375386112
complement(4011)-g, adbSNP:371601461
4017..4018+c, tdbSNP:76111882
4018+c, tdbSNP:8093
complement(4027)-g, adbSNP:56278731
complement(4035)-dbSNP:
complement(4035)-t, gdbSNP:62295471
complement(4038)-g, adbSNP:200132895
complement(4047)-g, adbSNP:201472926
complement(4048)-t, cdbSNP:200047571
complement(4050)-t, cdbSNP:370892923
complement(4051)-g, adbSNP:141809985
complement(4060)-g, adbSNP:55904229
complement(4061)-t, cdbSNP:377485573
complement(4070)-t, cdbSNP:145069695
4088+a, gdbSNP:1134921
complement(4090)-g, adbSNP:7693026
complement(4098)-g, adbSNP:142107211
complement(4111)-g, cdbSNP:200257448
complement(4117)-g, adbSNP:372672255
complement(4121)-g, adbSNP:369032235
complement(4122)-t, cdbSNP:372996323
complement(4139)-g, adbSNP:377044603
complement(4167)-t, gdbSNP:200834342
complement(4168)-g, adbSNP:374879777
complement(4182)-g, adbSNP:371902480
complement(4183)-t, cdbSNP:371367163
complement(4185)-t, gdbSNP:376847865
complement(4222)-g, adbSNP:191071523
complement(4251)-g, adbSNP:79187091
complement(4255..4256)-, cgggdbSNP:375745718
complement(4255)-g, adbSNP:187145550
complement(4270)-g, adbSNP:368661364
complement(4271)-t, cdbSNP:182878020
complement(4300)-t, cdbSNP:139662779
complement(4369)-g, adbSNP:143625399
4412+c, tdbSNP:6964
complement(4429)-g, adbSNP:368311589
complement(4483)-c, adbSNP:74375161
Gene SymbolGAK
Gene SynonymDNAJ26; DNAJC26
Chromosome4
Locus Map4p16
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001286833 Homo sapiens cyclin G associated kinase (GAK), transcript variant 2, mRNA. On-demand $1699.00 25
NM_005255 Homo sapiens cyclin G associated kinase (GAK), transcript variant 1, mRNA. On-demand $1699.00 25
XM_005272268 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X1, mRNA. On-demand $1699.00 25
XM_005272269 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006713874 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X7, mRNA. On-demand $1699.00 25
XM_005272270 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X3, mRNA. On-demand $1699.00 25
XM_005272272 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X5, mRNA. On-demand $1699.00 25
XM_005272273 PREDICTED: Homo sapiens cyclin G associated kinase (GAK), transcript variant X6, mRNA. On-demand $1699.00 25
Title Structure of cyclin G-associated kinase (GAK) trapped in different conformations using nanobodies .
Author Chaikuad A, Keates T, Vincke C, Kaufholz M, Zenn M, Zimmermann B, Gutierrez C, Zhang RG, Hatzos-Skintges C, Joachimiak A, Muyldermans S, Herberg FW, Knapp S and Muller S.
Journal Biochem. J. 459 (1), 59-69 (2014)
Title Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease .
Author Beilina A, Rudenko IN, Kaganovich A, Civiero L, Chau H, Kalia SK, Kalia LV, Lobbestael E, Chia R, Ndukwe K, Ding J, Nalls MA, Olszewski M, Hauser DN, Kumaran R, Lozano AM, Baekelandt V, Greene LE, Taymans JM, Greggio E and Cookson MR.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (7), 2626-2631 (2014)
Title A kinome-wide siRNA screen identifies multiple roles for protein kinases in hypoxic stress adaptation, including roles for IRAK4 and .
Author Pan J, Zhang J, Hill A, Lapan P, Berasi S, Bates B, Miller C and Haney S.
Journal J Biomol Screen 18 (7), 782-796 (2013)
Title Genetic variations of GAK in two Chinese Parkinson's disease populations: a case-control study .
Author Tseng WE, Chen CM, Chen YC, Yi Z, Tan EK and Wu YR.
Journal PLoS ONE 8 (6), E67506 (2013)
Title GAK rs1564282 and DGKQ rs11248060 increase the risk for Parkinson's disease in a Chinese population .
Author Chen YP, Song W, Huang R, Chen K, Zhao B, Li J, Yang Y and Shang HF.
Journal J Clin Neurosci 20 (6), 880-883 (2013)
Title Expression of auxilin or AP180 inhibits endocytosis by mislocalizing clathrin: evidence for formation of nascent pits containing AP1 or AP2 but not clathrin .
Author Zhao X, Greener T, Al-Hasani H, Cushman SW, Eisenberg E and Greene LE.
Journal J. Cell. Sci. 114 (PT 2), 353-365 (2001)
Title Identification of the universal cofactor (auxilin 2) in clathrin coat dissociation .
Author Umeda A, Meyerholz A and Ungewickell E.
Journal Eur. J. Cell Biol. 79 (5), 336-342 (2000)
Title Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells .
Author Greener T, Zhao X, Nojima H, Eisenberg E and Greene LE.
Journal J. Biol. Chem. 275 (2), 1365-1370 (2000)
Title Structure, expression, and chromosomal localization of human GAK .
Author Kimura SH, Tsuruga H, Yabuta N, Endo Y and Nojima H.
Journal Genomics 44 (2), 179-187 (1997)
Title GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain .
Author Kanaoka Y, Kimura SH, Okazaki I, Ikeda M and Nojima H.
Journal FEBS Lett. 402 (1), 73-80 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.