• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin G associated kinase (GAK), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005255 Homo sapiens cyclin G associated kinase (GAK), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_005255.2, 157384970
Length 4549 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cyclin G associated kinase (GAK), mRNA.
Product cyclin-G-associated kinase
Comment

Summary: In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. [provided by RefSeq, Jul 2008].

RefSeq NP_005246.2
CDS 200..4135
Misc Feature(1)125..127
Misc Feature(2)203..205
Misc Feature(3)203..205
Misc Feature(4)245..247
Misc Feature(5)350..1126
Misc Feature(6)359..1126
Misc Feature(7)order(359..361,398..400,404..406,494..496,566..577,
Misc Feature(8)order(359..361,398..400,404..406,494..496,566..577,
Misc Feature(9)order(584..586,590..592,716..718,722..724,728..730,
Misc Feature(10)order(767..787,866..874)
Misc Feature(11)1565..1567
Misc Feature(12)1907..2323
Misc Feature(13)2507..2509
Misc Feature(14)2675..2677
Misc Feature(15)2684..2686
Misc Feature(16)2699..2701
Misc Feature(17)3014..3016
Misc Feature(18)3485..3487
Misc Feature(19)3725..3727
Misc Feature(20)3752..3754
Misc Feature(21)<3977..4111
Misc Feature(22)order(4022..4030,4064..4066,4073..4078,4085..4090)
Exon (1)1..344
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (2)345..406
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (3)407..466
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (4)467..581
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (5)582..724
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (6)725..850
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (7)851..940
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (8)941..1076
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (9)1077..1189
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (10)1190..1280
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (11)1281..1404
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (12)1405..1454
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (13)1455..1603
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (14)1604..1726
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (15)1727..1860
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (16)1861..2055
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (17)2056..2173
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (18)2174..2253
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (19)2254..2447
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (20)2448..2594
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (21)2595..3071
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (22)3072..3242
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (23)3243..3365
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (24)3366..3482
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (25)3483..3707
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (26)3708..3856
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (27)3857..4033
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Exon (28)4034..4531
Gene:GAK
Gene Synonym:DNAJ26; DNAJC26
Translation MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDV GSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFL LLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL LSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPI GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNP EERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSG GLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAP HLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFS MKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCE VYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMA SMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAP PWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDS PPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQA CKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADP FGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGE PSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNP DPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPK ACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKT IAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-dbSNP:
complement(52)-t, cdbSNP:112514562
complement(71)-g, adbSNP:149820687
complement(125)-g, adbSNP:114747936
complement(427)-dbSNP:
complement(427)-t, cdbSNP:147271443
complement(485)-dbSNP:
complement(485)-g, cdbSNP:144020930
complement(496)-g, adbSNP:139759111
complement(507)-g, adbSNP:200829743
complement(518)-t, cdbSNP:138465573
complement(540)-g, adbSNP:150486451
complement(544)-t, cdbSNP:141559289
complement(557)-t, cdbSNP:1141284
complement(594)-dbSNP:
complement(594)-t, adbSNP:147981787
complement(671)-c, adbSNP:143423428
complement(673)-g, adbSNP:140230555
complement(690)-t, cdbSNP:146710139
complement(720)-t, adbSNP:185238939
complement(791)-dbSNP:
complement(791)-t, cdbSNP:144655362
complement(796)-t, cdbSNP:141049049
complement(845)-t, cdbSNP:144983014
complement(901)-dbSNP:
complement(901)-t, cdbSNP:144477169
complement(940)-t, cdbSNP:149963126
complement(975)-dbSNP:
complement(975)-t, cdbSNP:139175908
complement(991)-t, cdbSNP:151250837
complement(1008)-t, cdbSNP:144664799
complement(1027)-g, adbSNP:56058184
complement(1030)-t, cdbSNP:181152973
complement(1037)-g, adbSNP:200584785
complement(1039)-t, cdbSNP:116865703
complement(1040)-g, adbSNP:143895569
complement(1047)-g, adbSNP:200913305
complement(1054)-g, adbSNP:140104121
complement(1078)-dbSNP:
complement(1078)-g, adbSNP:202217789
complement(1123)-t, cdbSNP:144759809
complement(1149)-g, adbSNP:149432967
complement(1162)-g, adbSNP:200910077
complement(1237)-dbSNP:
complement(1237)-g, cdbSNP:144456621
complement(1249)-g, adbSNP:138971969
complement(1250)-t, cdbSNP:150270892
complement(1293)-dbSNP:
complement(1293)-g, adbSNP:41286657
complement(1308)-g, adbSNP:138522060
complement(1335)-g, cdbSNP:200248212
complement(1396)-t, cdbSNP:2279181
complement(1400)-t, cdbSNP:140876519
complement(1417)-dbSNP:
complement(1417)-g, adbSNP:111770118
complement(1436)-t, cdbSNP:11722461
complement(1469)-dbSNP:
complement(1469)-c, adbSNP:201737172
complement(1475)-c, adbSNP:143530189
complement(1492)-g, adbSNP:143820789
complement(1505)-t, cdbSNP:200352055
complement(1515)-t, cdbSNP:144343843
complement(1553)-t, cdbSNP:148874511
complement(1555)-t, gdbSNP:202112980
complement(1570)-t, cdbSNP:200172491
complement(1581)-t, cdbSNP:145652195
complement(1591)-c, adbSNP:144499981
complement(1594)-g, cdbSNP:140729096
complement(1599)-t, cdbSNP:147659460
complement(1609)-dbSNP:
complement(1609)-g, adbSNP:145448359
complement(1622)-t, cdbSNP:201272980
complement(1656)-g, adbSNP:1802538
complement(1663)-g, adbSNP:139283842
complement(1669)-t, cdbSNP:150848070
complement(1678)-g, adbSNP:142430163
complement(1679)-c, adbSNP:148765045
complement(1714)-g, adbSNP:146926083
complement(1741)-dbSNP:
complement(1741)-t, cdbSNP:187249639
complement(1743..1744)-, tdbSNP:34366710
complement(1793)-t, cdbSNP:143027704
complement(1801)-g, adbSNP:138537917
complement(1891)-dbSNP:
complement(1891)-c, adbSNP:75808664
complement(1927)-t, cdbSNP:192890169
complement(1937)-t, cdbSNP:34255232
complement(1951)-g, adbSNP:142467531
complement(1957)-g, adbSNP:35964990
complement(1974)-t, cdbSNP:150317412
complement(1978)-g, adbSNP:140333372
complement(1984)-g, cdbSNP:76741426
complement(1996)-g, adbSNP:147683833
complement(2006)-t, cdbSNP:146207272
complement(2008)-g, cdbSNP:202134985
complement(2009)-g, cdbSNP:142221119
complement(2017)-t, cdbSNP:147669221
complement(2084)-dbSNP:
complement(2084)-t, cdbSNP:183655284
complement(2096)-g, cdbSNP:201465712
complement(2104)-t, cdbSNP:145385558
complement(2110)-t, cdbSNP:41286651
complement(2126)-t, cdbSNP:145777066
complement(2137)-t, cdbSNP:41333249
complement(2147)-t, adbSNP:201736881
complement(2160)-t, cdbSNP:199572880
complement(2226)-dbSNP:
complement(2226)-t, cdbSNP:139900404
complement(2267)-dbSNP:
complement(2267)-t, cdbSNP:140022645
complement(2269)-t, cdbSNP:200009469
complement(2291)-g, adbSNP:200776520
complement(2293)-t, cdbSNP:146114266
complement(2347..2348)-, gdbSNP:34006401
complement(2349)-t, cdbSNP:199633903
complement(2350)-t, cdbSNP:144509628
complement(2357)-g, adbSNP:114856459
complement(2373)-g, adbSNP:146391123
complement(2414)-g, adbSNP:141655027
complement(2425)-c, adbSNP:147976989
complement(2491)-dbSNP:
complement(2491)-g, adbSNP:144503542
complement(2512)-t, cdbSNP:149263722
complement(2535)-g, adbSNP:1056673
complement(2551)-g, adbSNP:138831984
complement(2555)-t, cdbSNP:145911873
complement(2556)-g, adbSNP:201830875
complement(2557)-t, cdbSNP:79029749
complement(2558)-c, adbSNP:34585705
complement(2560)-g, adbSNP:112202640
complement(2579)-t, cdbSNP:147004796
complement(2581)-c, adbSNP:115244803
complement(2597)-dbSNP:
complement(2597)-t, cdbSNP:151239768
complement(2600)-t, cdbSNP:200947459
complement(2605..2606)-, cdbSNP:35072826
complement(2645)-t, cdbSNP:28640071
complement(2672)-t, cdbSNP:149152501
complement(2687)-t, cdbSNP:201570829
complement(2703)-g, adbSNP:199860840
complement(2713)-g, adbSNP:146609783
complement(2728)-g, adbSNP:144444649
complement(2735)-t, cdbSNP:201361013
complement(2750)-t, cdbSNP:199550885
complement(2765)-g, cdbSNP:139694554
complement(2777)-c, adbSNP:202089349
complement(2801)-g, cdbSNP:201584204
complement(2803)-t, cdbSNP:113722219
complement(2817)-c, adbSNP:1141285
complement(2829)-t, cdbSNP:149842313
complement(2843)-t, cdbSNP:139051032
complement(2864)-t, cdbSNP:150706546
complement(2892)-g, adbSNP:201137296
complement(2924)-t, cdbSNP:200903151
complement(2957)-t, cdbSNP:201968587
complement(3019)-t, cdbSNP:112225848
complement(3047)-g, cdbSNP:140439488
complement(3065)-t, cdbSNP:147165061
complement(3068)-t, cdbSNP:143655919
complement(3079)-dbSNP:
complement(3079)-t, gdbSNP:201308050
complement(3087)-g, adbSNP:138100414
complement(3096)-g, adbSNP:143612464
complement(3097)-t, cdbSNP:149317198
complement(3098)-t, adbSNP:199713255
complement(3108)-t, cdbSNP:112990443
complement(3146)-t, cdbSNP:138724620
complement(3156)-t, cdbSNP:200252102
complement(3160)-t, cdbSNP:150182601
complement(3172)-g, adbSNP:201506389
complement(3175)-g, adbSNP:200268987
complement(3189)-g, adbSNP:200039965
complement(3190)-t, cdbSNP:147912680
complement(3202)-t, cdbSNP:1064207
complement(3203)-t, cdbSNP:145680299
complement(3218)-g, adbSNP:202016140
complement(3224)-t, cdbSNP:140672161
complement(3226)-g, adbSNP:146838470
complement(3237)-t, cdbSNP:201196228
complement(3259)-dbSNP:
complement(3259)-t, cdbSNP:142955360
complement(3308)-t, gdbSNP:77455473
complement(3334)-g, adbSNP:1026738
complement(3351)-g, adbSNP:35227944
complement(3352)-t, cdbSNP:149678181
complement(3373)-dbSNP:
complement(3373)-t, gdbSNP:199816854
complement(3388)-c, adbSNP:190420984
complement(3393)-g, adbSNP:199901666
complement(3394)-t, cdbSNP:140272764
complement(3400)-g, adbSNP:200909207
complement(3414)-g, adbSNP:200884438
complement(3417)-g, cdbSNP:147175932
complement(3418)-g, cdbSNP:201241614
complement(3432)-t, gdbSNP:143488954
complement(3438)-g, adbSNP:139690161
complement(3439)-t, cdbSNP:150760089
complement(3460)-g, adbSNP:141358912
complement(3472)-g, adbSNP:79742312
complement(3505)-dbSNP:
complement(3505)-g, adbSNP:55697914
complement(3508)-c, adbSNP:142037003
complement(3525)-g, adbSNP:138890416
complement(3537)-g, adbSNP:145713462
complement(3542)-t, cdbSNP:145100581
complement(3559)-g, cdbSNP:55801437
complement(3567)-t, cdbSNP:145818077
complement(3597)-g, adbSNP:150254936
complement(3609)-g, adbSNP:56169884
complement(3611)-g, adbSNP:141041086
complement(3615)-g, cdbSNP:151123471
complement(3667)-g, adbSNP:200146913
complement(3677)-g, cdbSNP:142966472
complement(3687)-c, adbSNP:141977918
complement(3700)-g, adbSNP:147555555
complement(3702)-t, cdbSNP:56326341
complement(3746)-dbSNP:
complement(3746)-g, adbSNP:139521838
complement(3799)-g, adbSNP:75072999
complement(3804)-g, adbSNP:149731617
complement(3835)-g, adbSNP:139558681
complement(3852)-c, adbSNP:150598346
complement(3884)-dbSNP:
complement(3884)-g, adbSNP:142635741
complement(3931)-t, gdbSNP:138216547
complement(3948)-g, adbSNP:149742374
complement(3949)-t, cdbSNP:146290503
complement(3964)-g, adbSNP:141947839
complement(3993)-g, adbSNP:2306242
complement(4004)-g, adbSNP:143277193
complement(4005)-t, cdbSNP:149200314
complement(4017..4018)-t, cdbSNP:76111882
complement(4018)-t, cdbSNP:8093
complement(4027)-g, adbSNP:56278731
complement(4035)-dbSNP:
complement(4035)-t, gdbSNP:62295471
complement(4038)-g, adbSNP:200132895
complement(4047)-g, adbSNP:201472926
complement(4048)-t, cdbSNP:200047571
complement(4051)-g, adbSNP:141809985
complement(4060)-g, adbSNP:55904229
complement(4070)-t, cdbSNP:145069695
complement(4088)-g, adbSNP:1134921
complement(4090)-g, adbSNP:7693026
complement(4098)-g, adbSNP:142107211
complement(4111)-g, cdbSNP:200257448
complement(4167)-t, gdbSNP:200834342
complement(4222)-g, adbSNP:191071523
complement(4251)-g, adbSNP:79187091
complement(4255)-g, adbSNP:187145550
complement(4271)-t, cdbSNP:182878020
complement(4300)-t, cdbSNP:139662779
complement(4369)-g, adbSNP:143625399
complement(4412)-t, cdbSNP:6964
complement(4483)-c, adbSNP:74375161
Gene SymbolGAK
Gene SynonymDNAJ26; DNAJC26
Chromosome4
Locus Map4p16
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005255 Homo sapiens cyclin G associated kinase (GAK), mRNA. On-demand $1699.00 25
Title GWAS-linked GAK locus in Parkinson's disease in Han Chinese and meta-analysis .
Author Li,N.N., Chang,X.L., Mao,X.Y., Zhang,J.H., Zhao,D.M., Tan,E.K. and Peng,R.
Journal Hum. Genet. 131 (7), 1089-1093 (2012)
Title Cyclin G-associated kinase regulates protein phosphatase 2A by phosphorylation of its B'gamma subunit .
Author Naito,Y., Shimizu,H., Kasama,T., Sato,J., Tabara,H., Okamoto,A., Yabuta,N. and Nojima,H.
Journal Cell Cycle 11 (3), 604-616 (2012)
Title Comprehensive research synopsis and systematic meta-analyses in Parkinson's disease genetics: The PDGene database .
Author Lill,C.M., Roehr,J.T., McQueen,M.B., Kavvoura,F.K., Bagade,S., Schjeide,B.M., Schjeide,L.M., Meissner,E., Zauft,U., Allen,N.C., Liu,T., Schilling,M., Anderson,K.J., Beecham,G., Berg,D., Biernacka,J.M., Brice,A., DeStefano,A.L., Do,C.B., Eriksson,N., Factor,S.A., Farrer,M.J., Foroud,T., Gasser,T., Hamza,T., Hardy,J.A., Heutink,P., Hill-Burns,E.M., Klein,C., Latourelle,J.C., Maraganore,D.M., Martin,E.R., Martinez,M., Myers,R.H., Nalls,M.A., Pankratz,N., Payami,H., Satake,W., Scott,W.K., Sharma,M., Singleton,A.B., Stefansson,K., Toda,T., Tung,J.Y., Vance,J., Wood,N.W., Zabetian,C.P., Young,P., Tanzi,R.E., Khoury,M.J., Zipp,F., Lehrach,H., Ioannidis,J.P. and Bertram,L.
Journal PLoS Genet. 8 (3), E1002548 (2012)
Title Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease .
Author Do,C.B., Tung,J.Y., Dorfman,E., Kiefer,A.K., Drabant,E.M., Francke,U., Mountain,J.L., Goldman,S.M., Tanner,C.M., Langston,J.W., Wojcicki,A. and Eriksson,N.
Journal PLoS Genet. 7 (6), E1002141 (2011)
Title Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies .
Author Nalls,M.A., Plagnol,V., Hernandez,D.G., Sharma,M., Sheerin,U.M., Saad,M., Simon-Sanchez,J., Schulte,C., Lesage,S., Sveinbjornsdottir,S., Stefansson,K., Martinez,M., Hardy,J., Heutink,P., Brice,A., Gasser,T., Singleton,A.B. and Wood,N.W.
Journal Lancet 377 (9766), 641-649 (2011)
Title Expression of auxilin or AP180 inhibits endocytosis by mislocalizing clathrin: evidence for formation of nascent pits containing AP1 or AP2 but not clathrin .
Author Zhao,X., Greener,T., Al-Hasani,H., Cushman,S.W., Eisenberg,E. and Greene,L.E.
Journal J. Cell. Sci. 114 (PT 2), 353-365 (2001)
Title Identification of the universal cofactor (auxilin 2) in clathrin coat dissociation .
Author Umeda,A., Meyerholz,A. and Ungewickell,E.
Journal Eur. J. Cell Biol. 79 (5), 336-342 (2000)
Title Role of cyclin G-associated kinase in uncoating clathrin-coated vesicles from non-neuronal cells .
Author Greener,T., Zhao,X., Nojima,H., Eisenberg,E. and Greene,L.E.
Journal J. Biol. Chem. 275 (2), 1365-1370 (2000)
Title Structure, expression, and chromosomal localization of human GAK .
Author Kimura,S.H., Tsuruga,H., Yabuta,N., Endo,Y. and Nojima,H.
Journal Genomics 44 (2), 179-187 (1997)
Title GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain .
Author Kanaoka,Y., Kimura,S.H., Okazaki,I., Ikeda,M. and Nojima,H.
Journal FEBS Lett. 402 (1), 73-80 (1997)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.