• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GATA binding protein 6 (GATA6), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005257 Homo sapiens GATA binding protein 6 (GATA6), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_005257.5, 625180325
Length 3785 bp
Structure linear
Update Date 11-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens GATA binding protein 6 (GATA6), mRNA.
Product transcription factor GATA-6
Comment

Summary: This gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defects. [provided by RefSeq, Mar 2012].

RefSeq NP_005248.2
CDS 284..2071
Misc Feature(1)227..253
Misc Feature(2)227..253
Misc Feature(3)251..253
Misc Feature(4)251..253
Misc Feature(5)722..1426
Misc Feature(6)722..1426
Misc Feature(7)1085..1087
Misc Feature(8)1448..1585
Misc Feature(9)order(1451..1453,1460..1462,1514..1516,1523..1525)
Misc Feature(10)order(1478..1483,1487..1489,1514..1546)
Misc Feature(11)1610..1765
Misc Feature(12)order(1613..1615,1622..1624,1676..1678,1685..1687)
Misc Feature(13)order(1640..1645,1649..1651,1676..1708,1754..1756,
Exon (1)1..246
Gene:GATA6
Gene Synonym:GATA6
Exon (2)247..1418
Gene:GATA6
Gene Synonym:GATA6
Exon (3)1419..1585
Gene:GATA6
Gene Synonym:GATA6
Exon (4)1586..1711
Gene:GATA6
Gene Synonym:GATA6
Exon (5)1712..1799
Gene:GATA6
Gene Synonym:GATA6
Exon (6)1800..1903
Gene:GATA6
Gene Synonym:GATA6
Exon (7)1904..3776
Gene:GATA6
Gene Synonym:GATA6
Translation MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNC GTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQ AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA AAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGG AAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSL AAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLH SLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRP LAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASG AGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolGATA6
Gene SynonymGATA6
Chromosome18
Locus Map18q11.1-q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005257 Homo sapiens GATA binding protein 6 (GATA6), mRNA. On-demand TBD TBD
XM_005258248 PREDICTED: Homo sapiens GATA binding protein 6 (GATA6), transcript variant X1, mRNA. On-demand TBD TBD
Title Nicotine induces the up-regulation of the alpha7-nicotinic receptor (alpha7-nAChR) in human squamous cell lung cancer cells via the Sp1/GATA protein pathway .
Author Brown KC, Perry HE, Lau JK, Jones DV, Pulliam JF, Thornhill BA, Crabtree CM, Luo H, Chen YC and Dasgupta P.
Journal J. Biol. Chem. 288 (46), 33049-33059 (2013)
Title Spontaneously differentiated GATA6-positive human embryonic stem cells represent an important cellular step in human embryonic development; they are not just an artifact of in vitro culture .
Author Lee JH, Hong KS, Mantel C, Broxmeyer HE, Lee MR and Kim KS.
Journal Stem Cells Dev. 22 (20), 2706-2713 (2013)
Title Control of alveolar differentiation by the lineage transcription factors GATA6 and HOPX inhibits lung adenocarcinoma metastasis .
Author Cheung WK, Zhao M, Liu Z, Stevens LE, Cao PD, Fang JE, Westbrook TF and Nguyen DX.
Journal Cancer Cell 23 (6), 725-738 (2013)
Title Endothelial GATA-6 deficiency promotes pulmonary arterial hypertension .
Author Ghatnekar A, Chrobak I, Reese C, Stawski L, Seta F, Wirrig E, Paez-Cortez J, Markiewicz M, Asano Y, Harley R, Silver R, Feghali-Bostwick C and Trojanowska M.
Journal Am. J. Pathol. 182 (6), 2391-2406 (2013)
Title Two novel GATA6 mutations cause childhood-onset diabetes mellitus, pancreas malformation and congenital heart disease .
Author Gong M, Simaite D, Kuhnen P, Heldmann M, Spagnoli F, Blankenstein O, Hubner N, Hussain K and Raile K.
Journal Horm Res Paediatr 79 (4), 250-256 (2013)
Title A unique role of an amino terminal 16-residue region of long-type GATA-6 .
Author Takeda M, Obayashi K, Kobayashi A and Maeda M.
Journal J. Biochem. 135 (5), 639-650 (2004)
Title Distinct functions are implicated for the GATA-4, -5, and -6 transcription factors in the regulation of intestine epithelial cell differentiation .
Author Gao X, Sedgwick T, Shi YB and Evans T.
Journal Mol. Cell. Biol. 18 (5), 2901-2911 (1998)
Title GATA-6 DNA binding protein expressed in human gastric adenocarcinoma MKN45 cells .
Author Yoshida T, Sato R, Mahmood S, Kawasaki S, Futai M and Maeda M.
Journal FEBS Lett. 414 (2), 333-337 (1997)
Title Molecular cloning of human GATA-6 DNA binding protein: high levels of expression in heart and gut .
Author Huggon IC, Davies A, Gove C, Moscoso G, Moniz C, Foss Y, Farzaneh F and Towner P.
Journal Biochim. Biophys. Acta 1353 (2), 98-102 (1997)
Title The human GATA-6 gene: structure, chromosomal location, and regulation of expression by tissue-specific and mitogen-responsive signals .
Author Suzuki E, Evans T, Lowry J, Truong L, Bell DW, Testa JR and Walsh K.
Journal Genomics 38 (3), 283-290 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.