• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005261 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_005261.3, 260593687
Length 2195 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA.
Product GTP-binding protein GEM
Comment

Summary: The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 encode the same protein.

RefSeq NP_005252.1
CDS 240..1130
Misc Feature(1)117..119
Misc Feature(2)117..119
Misc Feature(3)465..1127
Misc Feature(4)465..1127
Misc Feature(5)465..1037
Misc Feature(6)483..506
Misc Feature(7)order(486..491,636..641)
Misc Feature(8)order(489..509,630..632,639..641,810..815,819..821,
Misc Feature(9)order(504..509,549..551,555..557,579..584,621..626,
Misc Feature(10)order(552..557,573..584)
Misc Feature(11)552..581
Misc Feature(12)558..560
Misc Feature(13)630..641
Misc Feature(14)order(636..641,666..677,684..695)
Misc Feature(15)810..821
Misc Feature(16)900..908
Misc Feature(17)1020..1022
Misc Feature(18)1035..1094
Misc Feature(19)1104..1106
Misc Feature(20)1107..1118
Exon (1)1..230
Gene:GEM
Gene Synonym:KIR
Exon (2)231..570
Gene:GEM
Gene Synonym:KIR
Exon (3)571..647
Gene:GEM
Gene Synonym:KIR
Exon (4)648..852
Gene:GEM
Gene Synonym:KIR
Exon (5)853..2187
Gene:GEM
Gene Synonym:KIR
Translation MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSS DSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMV DGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQ TEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR LRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(191)-t, cdbSNP:2250208
complement(283)-g, adbSNP:34218332
complement(300)-g, adbSNP:140549853
complement(317)-g, adbSNP:151310883
complement(343)-t, adbSNP:11539260
complement(351)-g, adbSNP:35262320
complement(365)-t, g, cdbSNP:35065846
complement(366)-g, c, adbSNP:2170363
complement(372)-g, adbSNP:201351710
complement(373)-g, adbSNP:17847126
complement(374..375)-, ggdbSNP:144891099
complement(387)-g, adbSNP:147133582
complement(422)-g, cdbSNP:145616833
complement(434)-t, cdbSNP:145046153
complement(490)-t, cdbSNP:201303048
complement(492)-g, cdbSNP:139494082
complement(560)-t, cdbSNP:201792479
complement(576)-dbSNP:
complement(576)-t, cdbSNP:201677240
complement(616)-g, adbSNP:184919570
complement(649)-dbSNP:
complement(649)-t, cdbSNP:200005791
complement(653)-t, cdbSNP:144483271
complement(724)-t, cdbSNP:149283301
complement(760)-t, gdbSNP:201731029
complement(781)-t, gdbSNP:74360159
complement(828)-g, adbSNP:187593880
complement(834)-g, adbSNP:138582164
complement(869)-dbSNP:
complement(869)-t, cdbSNP:199789983
complement(893)-g, adbSNP:138012458
complement(942)-t, cdbSNP:141761903
complement(948)-t, gdbSNP:138147292
complement(957)-g, adbSNP:190907564
complement(967)-t, cdbSNP:200768882
complement(968)-c, adbSNP:144950112
complement(978)-t, cdbSNP:141202489
complement(990)-g, adbSNP:200775391
complement(993)-g, adbSNP:138265181
complement(999)-c, adbSNP:143704827
complement(1012)-c, adbSNP:148957520
complement(1042)-t, cdbSNP:145789382
complement(1058)-g, adbSNP:201686704
complement(1059)-t, cdbSNP:149831559
complement(1094)-g, cdbSNP:142606096
complement(1151)-t, cdbSNP:111247129
complement(1380)-t, cdbSNP:150353666
complement(1415)-g, adbSNP:1050616
complement(1582)-t, cdbSNP:183081542
complement(1619)-t, cdbSNP:16916652
complement(1634)-g, adbSNP:112005671
complement(1703)-t, cdbSNP:141188432
complement(1712)-g, adbSNP:189913609
complement(1713)-g, adbSNP:17036
complement(1723)-g, adbSNP:17847131
complement(1842)-t, adbSNP:76872543
complement(1939)-t, cdbSNP:185901996
complement(1952)-t, cdbSNP:11985
complement(1963)-g, adbSNP:113737568
complement(1968)-g, adbSNP:17734604
complement(1975)-t, cdbSNP:1050627
complement(1986)-t, gdbSNP:2623167
complement(2055)-g, adbSNP:183026760
complement(2060)-t, cdbSNP:145900354
Gene SymbolGEM
Gene SynonymKIR
Chromosome8
Locus Map8q13-q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005261 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
NM_181702 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
Title The GTPase Gem and its partner Kif9 are required for chromosome alignment, spindle length control, and mitotic progression .
Author Andrieu,G., Quaranta,M., Leprince,C. and Hatzoglou,A.
Journal FASEB J. 26 (12), 5025-5034 (2012)
Title Molecular determinants of Gem protein inhibition of P/Q-type Ca2+ channels .
Author Fan,M., Zhang,W.K., Buraei,Z. and Yang,J.
Journal J. Biol. Chem. 287 (27), 22749-22758 (2012)
Title A systemic network for Chlamydia pneumoniae entry into human cells .
Author Wang,A., Johnston,S.C., Chou,J. and Dean,D.
Journal J. Bacteriol. 192 (11), 2809-2815 (2010)
Title An empirical framework for binary interactome mapping .
Author Venkatesan,K., Rual,J.F., Vazquez,A., Stelzl,U., Lemmens,I., Hirozane-Kishikawa,T., Hao,T., Zenkner,M., Xin,X., Goh,K.I., Yildirim,M.A., Simonis,N., Heinzmann,K., Gebreab,F., Sahalie,J.M., Cevik,S., Simon,C., de Smet,A.S., Dann,E., Smolyar,A., Vinayagam,A., Yu,H., Szeto,D., Borick,H., Dricot,A., Klitgord,N., Murray,R.R., Lin,C., Lalowski,M., Timm,J., Rau,K., Boone,C., Braun,P., Cusick,M.E., Roth,F.P., Hill,D.E., Tavernier,J., Wanker,E.E., Barabasi,A.L. and Vidal,M.
Journal Nat. Methods 6 (1), 83-90 (2009)
Title Biochemical and structural characterization of the gem GTPase .
Author Splingard,A., Menetrey,J., Perderiset,M., Cicolari,J., Regazzoni,K., Hamoudi,F., Cabanie,L., El Marjou,A., Wells,A., Houdusse,A. and de Gunzburg,J.
Journal J. Biol. Chem. 282 (3), 1905-1915 (2007)
Title Regulation of Ca2+ channel expression at the cell surface by the small G-protein kir/Gem .
Author Beguin,P., Nagashima,K., Gonoi,T., Shibasaki,T., Takahashi,K., Kashima,Y., Ozaki,N., Geering,K., Iwanaga,T. and Seino,S.
Journal Nature 411 (6838), 701-706 (2001)
Title Rad and Rad-related GTPases interact with calmodulin and calmodulin-dependent protein kinase II .
Author Moyers,J.S., Bilan,P.J., Zhu,J. and Kahn,C.R.
Journal J. Biol. Chem. 272 (18), 11832-11839 (1997)
Title Chromosomal organization and transcriptional regulation of human .
Author Santoro,T., Maguire,J., McBride,O.W., Avraham,K.B., Copeland,N.G., Jenkins,N.A. and Kelly,K.
Journal Genomics 30 (3), 558-564 (1995)
Title Transcriptional activation of a ras-like gene (kir) by oncogenic tyrosine kinases .
Author Cohen,L., Mohr,R., Chen,Y.Y., Huang,M., Kato,R., Dorin,D., Tamanoi,F., Goga,A., Afar,D., Rosenberg,N. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 12448-12452 (1994)
Title Gem: an induced, immediate early protein belonging to the Ras family .
Author Maguire,J., Santoro,T., Jensen,P., Siebenlist,U., Yewdell,J. and Kelly,K.
Journal Science 265 (5169), 241-244 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.