• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005261 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $348.00 $299.00 10

*Business Day

Related Services

RefSeq Version NM_005261.3, 260593687
Length 2195 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA.
Product GTP-binding protein GEM
Comment

Summary: The protein encoded by this gene belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 encode the same protein.

RefSeq NP_005252.1
CDS 240..1130
Misc Feature(1)117..119
Misc Feature(2)117..119
Misc Feature(3)465..1127
Misc Feature(4)465..1127
Misc Feature(5)465..1037
Misc Feature(6)483..506
Misc Feature(7)order(486..491,636..641)
Misc Feature(8)order(489..509,630..632,639..641,810..815,819..821,
Misc Feature(9)order(504..509,549..551,555..557,579..584,621..626,
Misc Feature(10)order(552..557,573..584)
Misc Feature(11)552..581
Misc Feature(12)558..560
Misc Feature(13)630..641
Misc Feature(14)order(636..641,666..677,684..695)
Misc Feature(15)810..821
Misc Feature(16)900..908
Misc Feature(17)1020..1022
Misc Feature(18)1035..1094
Misc Feature(19)1104..1106
Misc Feature(20)1107..1118
Exon (1)1..230
Gene:GEM
Gene Synonym:KIR
Exon (2)231..570
Gene:GEM
Gene Synonym:KIR
Exon (3)571..647
Gene:GEM
Gene Synonym:KIR
Exon (4)648..852
Gene:GEM
Gene Synonym:KIR
Exon (5)853..2187
Gene:GEM
Gene Synonym:KIR
Translation MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSS DSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMV DGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQ TEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVR LRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(191)-t, cdbSNP:2250208
complement(262)-g, adbSNP:374909426
complement(280)-t, cdbSNP:370415265
complement(283)-g, adbSNP:34218332
complement(300)-g, adbSNP:140549853
complement(317)-g, adbSNP:151310883
343+a, tdbSNP:11539260
complement(351)-g, adbSNP:35262320
365+c, g, tdbSNP:35065846
complement(366)-g, c, adbSNP:2170363
complement(372..373)-, ggdbSNP:144891099
complement(372)-g, adbSNP:201351710
373+a, gdbSNP:17847126
complement(387)-g, adbSNP:147133582
complement(422)-g, cdbSNP:145616833
complement(434)-t, cdbSNP:145046153
complement(490)-t, cdbSNP:201303048
complement(492)-g, cdbSNP:139494082
complement(560)-t, cdbSNP:201792479
complement(576)-dbSNP:
complement(576)-t, cdbSNP:201677240
complement(616)-g, adbSNP:184919570
complement(649)-dbSNP:
complement(649)-t, cdbSNP:200005791
complement(653)-t, cdbSNP:144483271
complement(692)-g, adbSNP:374944377
complement(693)-t, cdbSNP:372249284
complement(724)-t, cdbSNP:149283301
complement(760)-t, gdbSNP:201731029
complement(781)-t, gdbSNP:74360159
complement(794)-g, adbSNP:368254970
complement(808)-g, cdbSNP:375183063
complement(828)-g, adbSNP:187593880
complement(834)-g, adbSNP:138582164
complement(869)-dbSNP:
complement(869)-t, cdbSNP:199789983
complement(893)-g, adbSNP:138012458
complement(921)-t, cdbSNP:370285889
complement(942)-t, cdbSNP:141761903
complement(948)-t, gdbSNP:138147292
complement(949)-t, cdbSNP:368821999
complement(957)-g, adbSNP:190907564
complement(967)-t, cdbSNP:200768882
complement(978)-t, cdbSNP:141202489
complement(990)-g, adbSNP:200775391
complement(993)-g, adbSNP:138265181
complement(994)-t, cdbSNP:375369112
complement(1012)-c, adbSNP:148957520
complement(1042)-t, cdbSNP:145789382
complement(1058)-g, adbSNP:201686704
complement(1059)-t, cdbSNP:149831559
complement(1084)-t, gdbSNP:372371105
complement(1094)-g, cdbSNP:142606096
complement(1151)-t, cdbSNP:111247129
complement(1166)-t, cdbSNP:367607708
complement(1181)-g, adbSNP:374905687
complement(1380)-t, cdbSNP:150353666
1415+a, gdbSNP:1050616
complement(1415)-g, adbSNP:386513921
complement(1582)-t, cdbSNP:183081542
complement(1619)-t, cdbSNP:16916652
complement(1634)-g, adbSNP:112005671
1703+c, tdbSNP:141188432
complement(1712)-g, adbSNP:189913609
1713+a, gdbSNP:17036
complement(1713)-g, adbSNP:386541982
1723+a, gdbSNP:17847131
complement(1842)-t, adbSNP:76872543
complement(1939)-t, cdbSNP:185901996
complement(1952)-t, cdbSNP:386423024
1952+c, tdbSNP:11985
complement(1963)-g, adbSNP:113737568
complement(1968)-g, adbSNP:17734604
complement(1970)-t, cdbSNP:377650284
1975+c, tdbSNP:1050627
complement(1986)-t, gdbSNP:2623167
complement(2055)-g, adbSNP:183026760
complement(2060)-t, cdbSNP:145900354
Gene SymbolGEM
Gene SynonymKIR
Chromosome8
Locus Map8q13-q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_181702 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 2, mRNA. In-stock $348.00 $299.00 10
NM_005261 Homo sapiens GTP binding protein overexpressed in skeletal muscle (GEM), transcript variant 1, mRNA. In-stock $348.00 $299.00 10
Title The GTPase Gem and its partner Kif9 are required for chromosome alignment, spindle length control, and mitotic progression .
Author Andrieu G, Quaranta M, Leprince C and Hatzoglou A.
Journal FASEB J. 26 (12), 5025-5034 (2012)
Title Molecular determinants of Gem protein inhibition of P/Q-type Ca2+ channels .
Author Fan M, Zhang WK, Buraei Z and Yang J.
Journal J. Biol. Chem. 287 (27), 22749-22758 (2012)
Title A systemic network for Chlamydia pneumoniae entry into human cells .
Author Wang A, Johnston SC, Chou J and Dean D.
Journal J. Bacteriol. 192 (11), 2809-2815 (2010)
Title An empirical framework for binary interactome mapping .
Author Venkatesan K, Rual JF, Vazquez A, Stelzl U, Lemmens I, Hirozane-Kishikawa T, Hao T, Zenkner M, Xin X, Goh KI, Yildirim MA, Simonis N, Heinzmann K, Gebreab F, Sahalie JM, Cevik S, Simon C, de Smet AS, Dann E, Smolyar A, Vinayagam A, Yu H, Szeto D, Borick H, Dricot A, Klitgord N, Murray RR, Lin C, Lalowski M, Timm J, Rau K, Boone C, Braun P, Cusick ME, Roth FP, Hill DE, Tavernier J, Wanker EE, Barabasi AL and Vidal M.
Journal Nat. Methods 6 (1), 83-90 (2009)
Title Biochemical and structural characterization of the gem GTPase .
Author Splingard A, Menetrey J, Perderiset M, Cicolari J, Regazzoni K, Hamoudi F, Cabanie L, El Marjou A, Wells A, Houdusse A and de Gunzburg J.
Journal J. Biol. Chem. 282 (3), 1905-1915 (2007)
Title Regulation of Ca2+ channel expression at the cell surface by the small G-protein kir/Gem .
Author Beguin P, Nagashima K, Gonoi T, Shibasaki T, Takahashi K, Kashima Y, Ozaki N, Geering K, Iwanaga T and Seino S.
Journal Nature 411 (6838), 701-706 (2001)
Title Rad and Rad-related GTPases interact with calmodulin and calmodulin-dependent protein kinase II .
Author Moyers JS, Bilan PJ, Zhu J and Kahn CR.
Journal J. Biol. Chem. 272 (18), 11832-11839 (1997)
Title Chromosomal organization and transcriptional regulation of human .
Author Santoro T, Maguire J, McBride OW, Avraham KB, Copeland NG, Jenkins
Journal Genomics 30 (3), 558-564 (1995)
Title Transcriptional activation of a ras-like gene (kir) by oncogenic tyrosine kinases .
Author Cohen L, Mohr R, Chen YY, Huang M, Kato R, Dorin D, Tamanoi F, Goga A, Afar D and Rosenberg N.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 12448-12452 (1994)
Title Gem: an induced, immediate early protein belonging to the Ras family .
Author Maguire J, Santoro T, Jensen P, Siebenlist U, Yewdell J and Kelly K.
Journal Science 265 (5169), 241-244 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.