• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SMAD family member 4 (SMAD4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005359 Homo sapiens SMAD family member 4 (SMAD4), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_005359.5, 195963400
Length 8789 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SMAD family member 4 (SMAD4), mRNA.
Product mothers against decapentaplegic homolog 4
Comment

Summary: This gene encodes a member of the Smad family of signal transduction proteins. Smad proteins are phosphorylated and activated by transmembrane serine-threonine receptor kinases in response to TGF-beta signaling. The product of this gene forms homomeric complexes and heteromeric complexes with other activated Smad proteins, which then accumulate in the nucleus and regulate the transcription of target genes. This protein binds to DNA and recognizes an 8-bp palindromic sequence (GTCTAGAC) called the Smad-binding element (SBE). The Smad proteins are subject to complex regulation by post-translational modifications. Mutations or deletions in this gene have been shown to result in pancreatic cancer, juvenile polyposis syndrome, and hereditary hemorrhagic telangiectasia syndrome. [provided by RefSeq, Oct 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_005350.1
CDS 539..2197
Misc Feature(1)518..520
Misc Feature(2)578..952
Misc Feature(3)578..952
Misc Feature(4)647..649
Misc Feature(5)order(650..652,662..664,671..673,767..772,779..793,
Misc Feature(6)order(749..751,881..883,917..919,932..934)
Misc Feature(7)875..877
Misc Feature(8)875..877
Misc Feature(9)1013..1015
Misc Feature(10)1013..1015
Misc Feature(11)1361..1498
Misc Feature(12)1367..1369
Misc Feature(13)1496..2161
Misc Feature(14)order(1523..1525,1532..1534,1547..1552,1595..1609,
Misc Feature(15)1820..1822
Misc Feature(16)2057..2059
Misc Feature(17)2081..2083
Exon (1)1..411
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (2)412..787
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (3)788..962
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (4)963..992
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (5)993..1205
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (6)1206..1325
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (7)1326..1442
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (8)1443..1493
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (9)1494..1677
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (10)1678..1846
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (11)1847..1985
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Exon (12)1986..8772
Gene:SMAD4
Gene Synonym:DPC4; JIP; MADH4; MYHRS
Translation MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL HTMPIADPQPLD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
177+dbSNP:
177+a, gdbSNP:377412110
488+dbSNP:
488+c, tdbSNP:369978812
508+a, tdbSNP:200236229
558+c, tdbSNP:372316981
559+a, gdbSNP:142292491
576+a, gdbSNP:281875323
577+c, tdbSNP:376371717
640+a, gdbSNP:146104321
718+c, tdbSNP:201239868
832+dbSNP:
832+c, tdbSNP:202126703
839+g, tdbSNP:2229083
840+a, gdbSNP:377767323
892+a, gdbSNP:145988618
907+c, tdbSNP:140926102
911..912+, atdbSNP:377767324
919..920+, tgtctgtdbSNP:377767325
925+c, tdbSNP:150229208
941+c, tdbSNP:377767326
949+a, gdbSNP:201296880
968..969+dbSNP:
968..969+, tcdbSNP:377767328
975+a, tdbSNP:377767329
1002+dbSNP:
1002+a, gdbSNP:199790852
1048+a, gdbSNP:144226135
1054..1065+, gtccactgaaggdbSNP:377767330
1059+a, cdbSNP:138800446
1063+a, gdbSNP:368528856
1071+c, gdbSNP:377767331
1076+c, tdbSNP:377767332
1103+c, tdbSNP:140743238
1106+c, gdbSNP:61751988
1108+a, cdbSNP:200717327
1120+a, gdbSNP:145805120
1145+a, cdbSNP:199809905
1146+, cdbSNP:377767333
1185+a, gdbSNP:138386557
1198+c, tdbSNP:112891188
1224+dbSNP:
1224+g, tdbSNP:75667697
1230..1231+, gdbSNP:377767334
1237+c, tdbSNP:367964910
1267..1268+, ccgcdbSNP:377767335
1284+a, cdbSNP:371536364
1285+c, gdbSNP:372095620
1347+dbSNP:
1347+a, gdbSNP:143082783
1367..1368+, acdbSNP:377767336
1369..1370+, acdbSNP:377767337
1390+a, gdbSNP:144378484
1418+a, gdbSNP:7238500
1422+c, tdbSNP:370176106
1447+dbSNP:
1447+c, tdbSNP:141149381
1448+a, gdbSNP:375185293
1465+a, gdbSNP:369088915
1466..1467+, gcatdbSNP:377767338
1485+a, gdbSNP:377119288
1508+c, tdbSNP:377767339
1509+, gdbSNP:377767340
1520..1521+, tdbSNP:377767341
1526+a, gdbSNP:377767342
1527+a, gdbSNP:281875324
1575+, cdbSNP:377767343
1580..1581+, gtdbSNP:377767344
1592+a, gdbSNP:121912581
1593+a, gdbSNP:377767345
1596+a, cdbSNP:377767346
1610+g, tdbSNP:121912576
1619+a, c, g, tdbSNP:80338963
1620+a, g, tdbSNP:377767347
1624+c, tdbSNP:1801250
1625+c, tdbSNP:377767348
1626..1628+, gttdbSNP:377767349
1629+g, tdbSNP:377767350
1640..1641+, tcdbSNP:377767351
1644+a, gdbSNP:139569694
1651+, cdbSNP:377767352
1658+a, gdbSNP:201092541
1660+a, gdbSNP:373141146
1677+a, gdbSNP:377767353
1686+dbSNP:
1686+a, tdbSNP:377767355
1695+a, gdbSNP:121912580
1700+c, tdbSNP:80338964
1706+a, gdbSNP:377767356
1731+a, gdbSNP:377767357
1756+a, c, gdbSNP:145097078
1757+c, gdbSNP:147621330
1774+c, gdbSNP:121912577
1780+, adbSNP:377767358
1782..1785+, acagdbSNP:80338965
1806+, gdbSNP:377767359
1837+a, gdbSNP:370558697
1871+dbSNP:
1871+c, tdbSNP:377767360
1876+a, gdbSNP:372065822
1880+c, tdbSNP:377767361
1881..1903+, agcagcaggcggctactgcacaadbSNP:377767362
1899..1902+, cacadbSNP:377767363
1930+c, tdbSNP:140487104
1947..1948+, ccctdbSNP:377767364
1949..1973+, ggcccaggatcagtaggtggaatagdbSNP:377767365
1959+, cdbSNP:377767366
2010+dbSNP:
2010+g, tdbSNP:377767367
2015+c, gdbSNP:121912578
2016+a, cdbSNP:377767368
2024+c, tdbSNP:397518413
2036+a, gdbSNP:281875322
2037+c, tdbSNP:281875321
2038+a, gdbSNP:281875320
2063+a, tdbSNP:377767369
2065+a, gdbSNP:377767370
2067+g, tdbSNP:377767371
2081+a, tdbSNP:121912579
2082+, gdbSNP:377767372
2088..2089+, agagdbSNP:377767373
2102..2103+, ccdbSNP:377767374
2109+g, tdbSNP:377767375
2111+a, gdbSNP:149755320
2125..2126+, a, tadbSNP:377767376
2126+, cdbSNP:377767377
2132+, gdbSNP:377767378
2134..2135+cc, tdbSNP:377767379
2134+, cdbSNP:377767380
2135+c, gdbSNP:377767381
2136+c, g, tdbSNP:377767382
2138+c, tdbSNP:377767383
2145..2146+, tdbSNP:377767384
2149+c, tdbSNP:369598262
2150..2163+, gaagtacttcatacdbSNP:377767385
2173+g, tdbSNP:200595795
2185+a, gdbSNP:113545983
2191+a, gdbSNP:199526820
2208+c, tdbSNP:11663402
2209+a, gdbSNP:148687037
2223+c, tdbSNP:374562658
2288+c, gdbSNP:1049875
2377..2378+, tdbSNP:199787250
2609+a, gdbSNP:28403611
2659+a, gdbSNP:191822473
2780+g, tdbSNP:142236156
2786+a, gdbSNP:79955608
2882+a, cdbSNP:16952798
2883..2885+aaa, tdbSNP:386803201
2911+a, gdbSNP:371124732
2959+c, tdbSNP:371163706
3005+a, gdbSNP:183984903
3031+c, tdbSNP:190076139
3063..3064+, adbSNP:35675831
3366..3370+, ccatcdbSNP:138404813
complement(3376)-g, adbSNP:10470
3381+c, tdbSNP:375691219
3384+a, gdbSNP:181664459
3553+g, tdbSNP:78407704
3556+a, gdbSNP:185104256
3607+a, cdbSNP:199846258
3654..3655+, gdbSNP:34542515
3696..3697+, tdbSNP:371058219
3710+a, tdbSNP:75142398
3815+a, gdbSNP:56734884
3866+a, tdbSNP:145643623
3881+a, cdbSNP:146563723
3949+a, tdbSNP:79279451
4017+g, tdbSNP:141309481
4029+c, tdbSNP:190742750
4049+a, cdbSNP:182092812
4063+a, gdbSNP:4940037
4091+c, tdbSNP:185229497
4126..4127+, ttdbSNP:151147707
4138+g, tdbSNP:138909220
4207+a, gdbSNP:12327465
4319+a, gdbSNP:149424787
4469+c, gdbSNP:189547031
4532+a, gdbSNP:181201259
4558+a, gdbSNP:143842829
4685+a, tdbSNP:148190627
4698+a, gdbSNP:185349233
4859+a, tdbSNP:191637734
4884+a, gdbSNP:78321956
4993+g, tdbSNP:4939651
5111+c, tdbSNP:147352474
5116+a, gdbSNP:183785604
5124+a, gdbSNP:186751378
5167+a, gdbSNP:192485057
complement(5186)-g, adbSNP:139526377
5215..5216+, cdbSNP:35658729
5230..5231+, gtttttttdbSNP:144777629
5400+c, gdbSNP:183255810
5412+g, tdbSNP:186807250
5485+c, tdbSNP:191317135
5595+a, gdbSNP:182735651
5859+c, tdbSNP:114852346
5948..5949+, tdbSNP:202070730
5957+c, tdbSNP:12961857
6069..6070+, tdbSNP:373831598
6181+a, gdbSNP:376846816
6411+c, tdbSNP:368065509
6415+a, gdbSNP:143563979
6418+g, tdbSNP:150556996
6459+g, tdbSNP:371901376
6628+c, tdbSNP:188404885
6732+g, tdbSNP:377120415
6781..6782+, adbSNP:138276731
6782+c, gdbSNP:192635281
6784..6787+, gagadbSNP:374333786
6840+c, tdbSNP:369040052
6883+a, gdbSNP:185468281
6917+a, gdbSNP:189948351
6945+c, tdbSNP:375580807
6950+c, tdbSNP:112739300
7044+a, gdbSNP:192532745
7059+a, gdbSNP:139595540
7071+a, tdbSNP:372089678
7078+c, tdbSNP:184516281
7136..7137+, cdbSNP:34159851
7165+c, tdbSNP:149743165
7184+g, tdbSNP:188228460
7191..7192+, tdbSNP:113155703
7280+a, gdbSNP:145596898
7328+a, gdbSNP:12456284
7367+c, tdbSNP:117142232
7369+c, tdbSNP:369615750
7393+a, tdbSNP:74878872
complement(7456)-t, adbSNP:139414609
7556+c, tdbSNP:144187949
7585+c, tdbSNP:180715759
7616+c, tdbSNP:146551171
7728..7735+, gcgcacgcdbSNP:112458358
7728..7733+, gcgcacdbSNP:147193925
7732+a, gdbSNP:75712226
7733..7734+, cgdbSNP:147683428
7735..7748+, cgcgcgcgcacacadbSNP:144218127
7742..7743+, cadbSNP:372635676
7743..7744+, gcdbSNP:68159021
7744+a, gdbSNP:11662245
7748+acgcgcgcgcgcgcacaca, gcgdbSNP:74169183
7748+a, gdbSNP:202140561
7773..7774+(ca)7, 11, 12, 14, 15, 16, 17, 18, 8dbSNP:3220198
7774..7775+, cacadbSNP:56017493
7823+c, gdbSNP:75998234
7824+a, gdbSNP:185010226
7827..7830+, cacadbSNP:146919169
7834..7837+, acacdbSNP:368759758
7836..7837+, acdbSNP:372401829
7838+g, tdbSNP:376879710
7886..7888+, attdbSNP:149335502
7888..7890+, tatdbSNP:374306389
8030+a, gdbSNP:190039588
8058..8062+, aagaadbSNP:140241965
8060..8064+, gaaaadbSNP:78989198
8060+c, gdbSNP:200482328
8110+a, gdbSNP:370152218
8184+a, tdbSNP:12954419
complement(8191)-t, gdbSNP:3819122
8206+c, gdbSNP:181250637
8259+g, tdbSNP:12959147
8261+g, tdbSNP:12960005
8347+c, tdbSNP:187018810
8376..8377+, adbSNP:35671610
8405+c, tdbSNP:191403347
8494..8496+, agadbSNP:374856670
8606+a, gdbSNP:76830638
complement(8620)-g, cdbSNP:2282544
8710+c, tdbSNP:76020793
8719+c, tdbSNP:183472455
Gene SymbolSMAD4
Gene SynonymDPC4; JIP; MADH4; MYHRS
Chromosome18
Locus Map18q21.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005359 Homo sapiens SMAD family member 4 (SMAD4), mRNA. In-stock $509.00 $460.00 12
Title Zinc finger protein 451 is a novel Smad corepressor in transforming growth factor-beta signaling .
Author Feng Y, Wu H, Xu Y, Zhang Z, Liu T, Lin X and Feng XH.
Journal J. Biol. Chem. 289 (4), 2072-2083 (2014)
Title A study of Smad4 and Smad7 expression in surgically resected samples of gastric adenocarcinoma and their correlation with clinicopathological parameters and patient survival .
Author Zizi-Sermpetzoglou A, Myoteri D, Arkoumani E, Voultsos M and Marinis A.
Journal J BUON 19 (1), 221-227 (2014)
Title Targeted deletion of Smad4 shows it is required for transforming growth factor beta and activin signaling in colorectal cancer cells .
Author Zhou S, Buckhaults P, Zawel L, Bunz F, Riggins G, Dai JL, Kern SE, Kinzler KW and Vogelstein B.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (5), 2412-2416 (1998)
Title Human Smad3 and Smad4 are sequence-specific transcription activators .
Author Zawel L, Dai JL, Buckhaults P, Zhou S, Kinzler KW, Vogelstein B and Kern SE.
Journal Mol. Cell 1 (4), 611-617 (1998)
Title Nomenclature: vertebrate mediators of TGFbeta family signals .
Author Derynck,R., Gelbart,W.M., Harland,R.M., Heldin,C.H., Kern,S.E., Massague,J., Melton,D.A., Mlodzik,M., Padgett,R.W., Roberts,A.B., Smith,J., Thomsen,G.H., Vogelstein,B. and Wang,X.F.
Journal Cell 87 (2), 173 (1996)
Title Receptor-associated Mad homologues synergize as effectors of the TGF-beta response .
Author Zhang Y, Feng X, We R and Derynck R.
Journal Nature 383 (6596), 168-172 (1996)
Title DPC4, a candidate tumor suppressor gene at human chromosome 18q21.1 .
Author Hahn SA, Schutte M, Hoque AT, Moskaluk CA, da Costa LT, Rozenblum E, Weinstein CL, Fischer A, Yeo CJ, Hruban RH and Kern SE.
Journal Science 271 (5247), 350-353 (1996)
Title E2F-4, a new member of the E2F transcription factor family, interacts with p107 .
Author Ginsberg D, Vairo G, Chittenden T, Xiao ZX, Xu G, Wydner KL, DeCaprio JA, Lawrence JB and Livingston DM.
Journal Genes Dev. 8 (22), 2665-2679 (1994)
Title Juvenile Polyposis Syndrome .
Author Larsen Haidle,J. and Howe,J.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Hereditary Hemorrhagic Telangiectasia .
Author McDonald,J. and Pyeritz,R.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.