• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005360 Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_005360.4, 197313768
Length 2656 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, mRNA.
Product transcription factor Maf isoform a
Comment

Summary: The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010].


Transcript Variant: This variant (1) is spliced and encodes the longer isoform (a).

RefSeq NP_005351.2
CDS 824..2035
Misc Feature(1)662..664
Misc Feature(2)1079..1183
Misc Feature(3)1079..1183
Misc Feature(4)1199..1942
Misc Feature(5)1604..1882
Misc Feature(6)1685..1762
Misc Feature(7)1769..1834
Exon (1)1..1941
Gene:MAF
Gene Synonym:c-MAF; CCA4
Exon (2)1942..2647
Gene:MAF
Gene Synonym:c-MAF; CCA4
Translation MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPM STPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSPEDAVEALISN SHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPH YHHHHHHAAGHHHHPTAGAPGAAGSAAASAGGAGGAGGGGPASAGGGGGGGGGGGGGGAA GAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRG YAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENG SSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(22)-dbSNP:
complement(22)-t, cdbSNP:145695201
complement(44)-t, gdbSNP:2288066
complement(65)-g, adbSNP:143607018
complement(67..68)-, gdbSNP:201495658
complement(149)-g, adbSNP:188356862
complement(191)-t, cdbSNP:183508124
complement(298)-g, adbSNP:192477942
complement(343..344)-, tdbSNP:199989028
complement(390)-g, cdbSNP:140174065
complement(472)-g, adbSNP:2348179
complement(515)-g, adbSNP:184896051
complement(542)-t, cdbSNP:146161866
complement(672)-t, cdbSNP:3743596
complement(736)-t, cdbSNP:4081752
complement(801..809)-, cgccgccgcdbSNP:71885416
complement(813..815)-, cgcdbSNP:3072011
complement(815..817)-, gccdbSNP:5818251
complement(816)-, ccgdbSNP:68013176
complement(844)-t, cdbSNP:201215541
complement(902)-c, adbSNP:866051
complement(925)-t, cdbSNP:138395737
complement(932)-t, cdbSNP:145798231
complement(946)-g, cdbSNP:141946872
complement(1063)-g, cdbSNP:186864493
complement(1072)-t, cdbSNP:138056779
complement(1084)-g, adbSNP:202016553
complement(1131)-t, gdbSNP:200484908
complement(1143)-t, cdbSNP:11549798
complement(1684)-g, c, adbSNP:139380519
complement(1686)-g, cdbSNP:121917735
complement(1705)-t, cdbSNP:140303158
complement(1713)-g, adbSNP:121917736
complement(1747)-g, cdbSNP:151185935
complement(1843)-t, cdbSNP:200671196
complement(1851)-g, adbSNP:201126542
complement(1882)-c, adbSNP:1046957
complement(1906)-t, cdbSNP:182176065
complement(1973)-dbSNP:
complement(1973)-g, cdbSNP:142230647
complement(2002)-t, cdbSNP:149118803
complement(2047)-g, cdbSNP:202097169
complement(2054)-t, cdbSNP:200061958
complement(2067)-, adbSNP:148849596
complement(2109)-g, cdbSNP:182082658
complement(2114)-g, cdbSNP:141266301
complement(2116)-g, cdbSNP:113690274
complement(2192)-t, gdbSNP:116860161
complement(2211)-g, adbSNP:2287974
complement(2220)-g, cdbSNP:30412
complement(2254)-g, cdbSNP:78847445
complement(2352..2353)-, cdbSNP:36012656
complement(2389)-t, gdbSNP:144466827
complement(2401)-g, adbSNP:75556494
complement(2435)-g, adbSNP:30411
complement(2492)-g, adbSNP:148587414
complement(2524)-t, cdbSNP:144766735
complement(2603)-t, cdbSNP:189561489
Gene SymbolMAF
Gene Synonymc-MAF; CCA4
Chromosome16
Locus Map16q22-q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001031804 Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 2, mRNA. On-demand TBD TBD
NM_005360 Homo sapiens v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (MAF), transcript variant 1, mRNA. On-demand TBD TBD
Title Host factor transcriptional regulation contributes to preferential expression of HIV type 1 in IL-4-producing CD4 T cells .
Author Zhang,M., Clausell,A., Robinson,T., Yin,J., Chen,E., Johnson,L., Weiss,G., Sabbaj,S., Lowe,R.M., Wagner,F.H., Goepfert,P.A., Kutsch,O. and Cron,R.Q.
Journal J. Immunol. 189 (6), 2746-2757 (2012)
Title Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations .
Author Okada,Y., Sim,X., Go,M.J., Wu,J.Y., Gu,D., Takeuchi,F., Takahashi,A., Maeda,S., Tsunoda,T., Chen,P., Lim,S.C., Wong,T.Y., Liu,J., Young,T.L., Aung,T., Seielstad,M., Teo,Y.Y., Kim,Y.J., Lee,J.Y., Han,B.G., Kang,D., Chen,C.H., Tsai,F.J., Chang,L.C., Fann,S.J., Mei,H., Rao,D.C., Hixson,J.E., Chen,S., Katsuya,T., Isono,M., Ogihara,T., Chambers,J.C., Zhang,W., Kooner,J.S., Albrecht,E., Yamamoto,K., Kubo,M., Nakamura,Y., Kamatani,N., Kato,N., He,J., Chen,Y.T., Cho,Y.S., Tai,E.S. and Tanaka,T.
Journal Nat. Genet. 44 (8), 904-909 (2012)
Title Meta-analysis of two genome-wide association studies identifies four genetic loci associated with thyroid function .
Author Rawal,R., Teumer,A., Volzke,H., Wallaschofski,H., Ittermann,T., Asvold,B.O., Bjoro,T., Greiser,K.H., Tiller,D., Werdan,K., zu Schwabedissen,H.E., Doering,A., Illig,T., Gieger,C., Meisinger,C. and Homuth,G.
Journal Hum. Mol. Genet. 21 (14), 3275-3282 (2012)
Title Bcl6 and Maf cooperate to instruct human follicular helper CD4 T cell differentiation .
Author Kroenke,M.A., Eto,D., Locci,M., Cho,M., Davidson,T., Haddad,E.K. and Crotty,S.
Journal J. Immunol. 188 (8), 3734-3744 (2012)
Title The transcription factor c-Maf controls touch receptor development and function .
Author Wende,H., Lechner,S.G., Cheret,C., Bourane,S., Kolanczyk,M.E., Pattyn,A., Reuter,K., Munier,F.L., Carroll,P., Lewin,G.R. and Birchmeier,C.
Journal Science 335 (6074), 1373-1376 (2012)
Title TH2 cytokine-associated transcription factors in atopic and nonatopic asthma: evidence for differential signal transducer and activator of transcription 6 expression .
Author Christodoulopoulos,P., Cameron,L., Nakamura,Y., Lemiere,C., Muro,S., Dugas,M., Boulet,L.P., Laviolette,M., Olivenstein,R. and Hamid,Q.
Journal J. Allergy Clin. Immunol. 107 (4), 586-591 (2001)
Title Frequent dysregulation of the c-maf proto-oncogene at 16q23 by translocation to an Ig locus in multiple myeloma .
Author Chesi,M., Bergsagel,P.L., Shonukan,O.O., Martelli,M.L., Brents,L.A., Chen,T., Schrock,E., Ried,T. and Kuehl,W.M.
Journal Blood 91 (12), 4457-4463 (1998)
Title c-Maf interacts with c-Myb to regulate transcription of an early myeloid gene during differentiation .
Author Hedge,S.P., Kumar,A., Kurschner,C. and Shapiro,L.H.
Journal Mol. Cell. Biol. 18 (5), 2729-2737 (1998)
Title USF2/FIP associates with the b-Zip transcription factor, c-Maf, via its bHLH domain and inhibits c-Maf DNA binding activity .
Author Kurschner,C. and Morgan,J.I.
Journal Biochem. Biophys. Res. Commun. 231 (2), 333-339 (1997)
Title Maf and Nrl can bind to AP-1 sites and form heterodimers with Fos and Jun .
Author Kerppola,T.K. and Curran,T.
Journal Oncogene 9 (3), 675-684 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.