• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myeloproliferative leukemia virus oncogene (MPL), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005373 Homo sapiens myeloproliferative leukemia virus oncogene (MPL), mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_005373.2, 172072641
Length 3645 bp
Structure linear
Update Date 14-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myeloproliferative leukemia virus oncogene (MPL), mRNA.
Product thrombopoietin receptor precursor
Comment

Summary: In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_005364.1
CDS 46..1953
Misc Feature(1)19..21
Misc Feature(2)19..21
Misc Feature(3)118..429
Misc Feature(4)1219..1500
Misc Feature(5)order(1402..1404,1462..1464)
Misc Feature(6)1465..1479
Misc Feature(7)order(1465..1470,1474..1479)
Misc Feature(8)1519..1584
Misc Feature(9)1627..1653
Misc Feature(10)1921..1923
Misc Feature(11)1936..1938
Exon (1)1..124
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (2)125..257
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (3)258..436
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (4)437..735
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (5)736..898
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (6)899..1025
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (7)1026..1210
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (8)1211..1353
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (9)1354..1513
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (10)1514..1610
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (11)1611..1698
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (12)1699..3645
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Translation MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
50+c, tdbSNP:188798468
117+c, tdbSNP:148327872
156+dbSNP:
156+c, tdbSNP:142697469
162+g, tdbSNP:17292650
172+c, tdbSNP:148434485
173+a, gdbSNP:147938568
179+c, tdbSNP:145714475
218+c, tdbSNP:6087
219+a, gdbSNP:141077413
230+c, tdbSNP:201727975
254+c, tdbSNP:61754776
255+a, gdbSNP:6086
269+dbSNP:
269+a, gdbSNP:148276667
306+g, tdbSNP:150725726
350+c, gdbSNP:28928907
351+c, tdbSNP:140354935
358+c, tdbSNP:145313814
370+c, tdbSNP:202206935
384+c, tdbSNP:142446401
385+a, gdbSNP:12731981
427+g, tdbSNP:201101813
453+dbSNP:
453+c, gdbSNP:146579984
525+a, cdbSNP:150145932
547+a, gdbSNP:6088
562+c, gdbSNP:202137992
588+c, tdbSNP:17572791
593+c, tdbSNP:137952228
594+a, gdbSNP:147130173
601+c, tdbSNP:121913610
638+a, gdbSNP:201050642
664+a, gdbSNP:201385967
667+a, cdbSNP:111460954
700+c, gdbSNP:142737453
722+a, cdbSNP:141063159
735+a, gdbSNP:16830693
757+dbSNP:
757+g, tdbSNP:144210383
799+c, tdbSNP:141311765
814+c, tdbSNP:121913611
838+c, tdbSNP:117656396
868+a, cdbSNP:28928908
901+dbSNP:
901+a, gdbSNP:200023952
929+a, gdbSNP:113696793
966+a, cdbSNP:150338376
967+a, cdbSNP:200993480
985+g, tdbSNP:200502271
1007+a, gdbSNP:149265851
1008+g, tdbSNP:138636505
1023+c, tdbSNP:202119310
1029..1030+dbSNP:
1029..1030+, cdbSNP:66678971
1032+c, tdbSNP:144491350
1047+c, tdbSNP:141526418
1048+a, gdbSNP:139770726
1085+a, cdbSNP:61769040
1088+a, gdbSNP:146071368
1096+c, tdbSNP:201998783
1147+g, tdbSNP:149810307
1165+a, gdbSNP:190983971
1242+dbSNP:
1242+a, gdbSNP:148945299
1249+c, tdbSNP:147608148
1311+a, gdbSNP:34928544
1322+a, gdbSNP:200454070
1374+dbSNP:
1374+a, gdbSNP:191392918
1444+a, gdbSNP:146120160
1518+dbSNP:
1518+a, gdbSNP:121913613
1533+c, tdbSNP:140091584
1559+a, gdbSNP:121913614
1581+a, gdbSNP:137990502
1588..1589+aa, tgdbSNP:121913616
1589+g, tdbSNP:121913615
1615+dbSNP:
1615+c, tdbSNP:146372205
1618+a, cdbSNP:143100182
1654+c, tdbSNP:148784027
1655+a, gdbSNP:3820551
1674+c, tdbSNP:150816330
1698+a, gdbSNP:200328093
1711+dbSNP:
1711+g, tdbSNP:150004498
1714+g, tdbSNP:142161843
1728+a, gdbSNP:202022473
1784+c, tdbSNP:147851301
1820+a, gdbSNP:200500828
1839+c, tdbSNP:143457144
1848+c, tdbSNP:140794721
1886+c, gdbSNP:138450235
1895+c, gdbSNP:201475315
1938+, tdbSNP:67746978
1949+c, tdbSNP:121913612
2047+a, cdbSNP:77858532
2064+c, gdbSNP:186807040
2107+, tdbSNP:67416726
2224+c, tdbSNP:144331455
2317+c, tdbSNP:138892634
2526+a, gdbSNP:192016153
2578+c, tdbSNP:182807417
2615+a, gdbSNP:1763698
2625+c, gdbSNP:75425122
2627+a, tdbSNP:77858547
2629..2630+, aaaadbSNP:71307654
2629+, ttttt, ttttttttdbSNP:10572898
2630+a, tdbSNP:79736278
2662+c, tdbSNP:185654501
2701+c, tdbSNP:190071085
2733+a, gdbSNP:182233357
2867+c, tdbSNP:186474263
2910+g, tdbSNP:146322472
3007+a, gdbSNP:139528456
3030..3031+, cdbSNP:35225340
3069+a, gdbSNP:144177827
3133+a, gdbSNP:117166528
3173+c, tdbSNP:6689207
3214+a, gdbSNP:193122067
3405+c, tdbSNP:139194573
3425+c, tdbSNP:183926045
3439+c, tdbSNP:149940158
3459+a, gdbSNP:115780311
3478+c, tdbSNP:144988440
3541+c, tdbSNP:188722111
3556+a, cdbSNP:142139493
3645+, adbSNP:35728788
Gene SymbolMPL
Gene SynonymC-MPL; CD110; MPLV; THCYT2; TPOR
Chromosome1
Locus Map1p34
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005373 Homo sapiens myeloproliferative leukemia virus oncogene (MPL), mRNA. In-stock $639.00 $590.00 15
Title Tryptophan at the transmembrane-cytosolic junction modulates thrombopoietin receptor dimerization and activation .
Author Defour,J.P., Itaya,M., Gryshkova,V., Brett,I.C., Pecquet,C., Sato,T., Smith,S.O. and Constantinescu,S.N.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (7), 2540-2545 (2013)
Title Thrombopoietin/MPL participates in initiating and maintaining RUNX1-ETO acute myeloid leukemia via PI3K/AKT signaling .
Author Pulikkan,J.A., Madera,D., Xue,L., Bradley,P., Landrette,S.F., Kuo,Y.H., Abbas,S., Zhu,L.J., Valk,P. and Castilla,L.H.
Journal Blood 120 (4), 868-879 (2012)
Title The association of JAK2V617F mutation and leukocytosis with thrombotic events in essential thrombocythemia .
Author Hsiao,H.H., Yang,M.Y., Liu,Y.C., Lee,C.P., Yang,W.C., Liu,T.C., Chang,C.S. and Lin,S.F.
Journal Exp. Hematol. 35 (11), 1704-1707 (2007)
Title Analysis of JAK3, JAK2, and C-MPL mutations in transient myeloproliferative disorder and myeloid leukemia of Down syndrome blasts in children with Down syndrome .
Author Norton,A., Fisher,C., Liu,H., Wen,Q., Mundschau,G., Fuster,J.L., Hasle,H., Zeller,B., Webb,D.K., O'Marcaigh,A., Sorrell,A., Hilden,J., Gamis,A., Crispino,J.D. and Vyas,P.
Journal Blood 110 (3), 1077-1079 (2007)
Title Anaemia characterises patients with myelofibrosis harbouring Mpl mutation .
Author Guglielmelli,P., Pancrazzi,A., Bergamaschi,G., Rosti,V., Villani,L., Antonioli,E., Bosi,A., Barosi,G. and Vannucchi,A.M.
Journal Br. J. Haematol. 137 (3), 244-247 (2007)
Title Concurrent MPL515 and JAK2V617F mutations in myelofibrosis: chronology of clonal emergence and changes in mutant allele burden over time .
Author Lasho,T.L., Pardanani,A., McClure,R.F., Mesa,R.A., Levine,R.L., Gilliland,D.G. and Tefferi,A.
Journal Br. J. Haematol. 135 (5), 683-687 (2006)
Title MPL515 mutations in myeloproliferative and other myeloid disorders: a study of 1182 patients .
Author Pardanani,A.D., Levine,R.L., Lasho,T., Pikman,Y., Mesa,R.A., Wadleigh,M., Steensma,D.P., Elliott,M.A., Wolanskyj,A.P., Hogan,W.J., McClure,R.F., Litzow,M.R., Gilliland,D.G. and Tefferi,A.
Journal Blood 108 (10), 3472-3476 (2006)
Title MPLW515L is a novel somatic activating mutation in myelofibrosis with myeloid metaplasia .
Author Pikman,Y., Lee,B.H., Mercher,T., McDowell,E., Ebert,B.L., Gozo,M., Cuker,A., Wernig,G., Moore,S., Galinsky,I., DeAngelo,D.J., Clark,J.J., Lee,S.J., Golub,T.R., Wadleigh,M., Gilliland,D.G. and Levine,R.L.
Journal PLoS Med. 3 (7), E270 (2006)
Title Molecular cloning and characterization of MPL, the human homolog of the v-mpl oncogene: identification of a member of the hematopoietic growth factor receptor superfamily .
Author Vigon,I., Mornon,J.P., Cocault,L., Mitjavila,M.T., Tambourin,P., Gisselbrecht,S. and Souyri,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (12), 5640-5644 (1992)
Title A putative truncated cytokine receptor gene transduced by the myeloproliferative leukemia virus immortalizes hematopoietic progenitors .
Author Souyri,M., Vigon,I., Penciolelli,J.F., Heard,J.M., Tambourin,P. and Wendling,F.
Journal Cell 63 (6), 1137-1147 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.