• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens MPL proto-oncogene, thrombopoietin receptor (MPL), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu28553 Homo sapiens MPL proto-oncogene, thrombopoietin receptor (MPL), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu28553C Homo sapiens MPL proto-oncogene, thrombopoietin receptor (MPL), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005373.2, 172072641
Length 1908 bp
Structure linear
Update Date 28-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens MPL proto-oncogene, thrombopoietin receptor (MPL), mRNA.
Product thrombopoietin receptor precursor
Comment

Summary: In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_005364.1
CDS 46..1953
Misc Feature(1)19..21
Misc Feature(2)19..21
Misc Feature(3)118..429
Misc Feature(4)442..879
Misc Feature(5)order(442..444,787..789,832..834)
Misc Feature(6)order(850..855,859..864)
Misc Feature(7)1228..1500
Misc Feature(8)order(1402..1404,1462..1464)
Misc Feature(9)1465..1479
Misc Feature(10)order(1465..1470,1474..1479)
Misc Feature(11)1519..1584
Misc Feature(12)1627..1653
Misc Feature(13)1921..1923
Misc Feature(14)1936..1938
Exon (1)1..124
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (2)125..257
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (3)258..436
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (4)437..735
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (5)736..898
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (6)899..1025
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (7)1026..1210
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (8)1211..1353
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (9)1354..1513
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (10)1514..1610
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (11)1611..1698
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Exon (12)1699..3645
Gene:MPL
Gene Synonym:C-MPL; CD110; MPLV; THCYT2; TPOR
Translation MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+c, tdbSNP:376992297
50+c, tdbSNP:188798468
117+c, tdbSNP:148327872
156+dbSNP:
156+c, tdbSNP:142697469
162+g, tdbSNP:17292650
172+c, tdbSNP:148434485
173+a, gdbSNP:147938568
179+c, tdbSNP:145714475
218+c, tdbSNP:6087
219+a, gdbSNP:141077413
230+c, tdbSNP:201727975
254+c, tdbSNP:61754776
255+a, gdbSNP:6086
257+a, gdbSNP:368753117
269+dbSNP:
269+a, gdbSNP:148276667
306+g, tdbSNP:150725726
340+a, gdbSNP:267598614
350+c, gdbSNP:28928907
351+c, tdbSNP:140354935
358+c, tdbSNP:145313814
363+a, gdbSNP:370001905
370+c, tdbSNP:202206935
384+c, tdbSNP:142446401
385+a, gdbSNP:12731981
427+g, tdbSNP:201101813
443+dbSNP:
443+c, tdbSNP:371227552
446+c, tdbSNP:375532666
453+c, gdbSNP:146579984
490+a, gdbSNP:267598615
525+a, cdbSNP:150145932
547+a, gdbSNP:6088
562+c, gdbSNP:202137992
588+c, tdbSNP:17572791
593+c, tdbSNP:137952228
594+a, gdbSNP:147130173
601+c, tdbSNP:121913610
638+a, gdbSNP:201050642
652+a, gdbSNP:370346540
664+a, gdbSNP:201385967
667+a, cdbSNP:111460954
700+c, gdbSNP:142737453
722+a, cdbSNP:141063159
735+a, gdbSNP:16830693
757+dbSNP:
757+g, tdbSNP:144210383
775+c, tdbSNP:368330272
799+c, tdbSNP:141311765
814+c, tdbSNP:121913611
838+c, tdbSNP:117656396
841+a, gdbSNP:367877736
868+a, cdbSNP:28928908
901+dbSNP:
901+a, gdbSNP:200023952
929+a, gdbSNP:113696793
967+a, cdbSNP:200993480
985+g, tdbSNP:200502271
988+a, tdbSNP:372164360
1007+a, gdbSNP:149265851
1008+g, tdbSNP:138636505
1023+c, tdbSNP:202119310
1032+dbSNP:
1032+c, tdbSNP:144491350
1039+a, gdbSNP:369486165
1047+c, tdbSNP:141526418
1048+a, gdbSNP:139770726
1085+a, cdbSNP:61769040
1088+a, gdbSNP:146071368
1096+c, tdbSNP:201998783
1147+g, tdbSNP:149810307
1165+a, gdbSNP:190983971
1213+dbSNP:
1213+c, tdbSNP:373621350
1218+c, tdbSNP:376638782
1242+a, gdbSNP:148945299
1249+c, tdbSNP:147608148
1297+a, gdbSNP:371232858
1303+c, gdbSNP:373326579
complement(1311)-g, adbSNP:34928544
1322+a, gdbSNP:200454070
1374+dbSNP:
1374+a, gdbSNP:191392918
1396+c, tdbSNP:368378328
1444+a, gdbSNP:146120160
1518+dbSNP:
1518+a, gdbSNP:121913613
1533+c, tdbSNP:140091584
1536+c, tdbSNP:374982038
1559+a, gdbSNP:121913614
1581+a, gdbSNP:137990502
1587+a, gdbSNP:367960803
1588..1589+aa, tgdbSNP:121913616
1589+g, tdbSNP:121913615
1615+dbSNP:
1615+c, tdbSNP:146372205
1618+a, cdbSNP:143100182
1650+g, tdbSNP:371286903
1654+c, tdbSNP:148784027
1655+a, gdbSNP:3820551
1657+c, gdbSNP:374829965
1666+c, tdbSNP:369156948
1674+c, tdbSNP:150816330
1676+c, gdbSNP:372747889
1679+a, gdbSNP:369504259
1680+c, tdbSNP:374221815
1695+c, tdbSNP:377715574
1698+a, gdbSNP:200328093
1711+dbSNP:
1711+g, tdbSNP:150004498
1714+g, tdbSNP:142161843
1725+g, tdbSNP:368615234
1728+a, gdbSNP:202022473
1784+c, tdbSNP:147851301
1820+a, gdbSNP:200500828
1839+c, tdbSNP:143457144
1848+c, tdbSNP:140794721
1854+a, cdbSNP:374553815
1886+c, gdbSNP:138450235
1895+c, gdbSNP:201475315
1918+g, tdbSNP:367594982
1949+c, tdbSNP:121913612
1968+c, tdbSNP:371858774
1969+g, tdbSNP:375202792
1999+a, gdbSNP:369565019
2047+a, cdbSNP:77858532
2064+c, gdbSNP:186807040
complement(2224)-t, cdbSNP:144331455
2317+c, tdbSNP:138892634
2526+a, gdbSNP:192016153
2578+c, tdbSNP:182807417
complement(2615)-g, adbSNP:1763698
2625+c, gdbSNP:75425122
2627+a, tdbSNP:77858547
2630+a, tdbSNP:79736278
2662+c, tdbSNP:185654501
2701+c, tdbSNP:190071085
2733+a, gdbSNP:182233357
2867+c, tdbSNP:186474263
2910+g, tdbSNP:146322472
3007+a, gdbSNP:139528456
3032..3033+, cdbSNP:35225340
complement(3069)-g, adbSNP:144177827
3133+a, gdbSNP:117166528
3173+c, tdbSNP:6689207
3214+a, gdbSNP:193122067
3244+, cdbSNP:372021668
3252+a, gdbSNP:375523167
3405+c, tdbSNP:139194573
3425+c, tdbSNP:183926045
complement(3439)-t, cdbSNP:149940158
3459+a, gdbSNP:115780311
3478+c, tdbSNP:144988440
3541+c, tdbSNP:188722111
complement(3556)-c, adbSNP:142139493
Gene SymbolMPL
Gene SynonymC-MPL; CD110; MPLV; THCYT2; TPOR
Chromosome1
Locus Map1p34
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005373 Homo sapiens MPL proto-oncogene, thrombopoietin receptor (MPL), mRNA. In-stock $99.00 5-7
Title Molecular genetic tests for JAK2V617F, Exon12_JAK2 and MPLW515K/L are highly informative in the evaluation of patients suspected to have BCR-ABL1-negative myeloproliferative neoplasms .
Author dos Santos MT, Mitne-Neto M, Miyashiro K, Chauffaille Mde L and Rizzatti EG.
Journal J. Clin. Pathol. 67 (2), 176-178 (2014)
Title VEGF controls lung Th2 inflammation via the miR-1-Mpl (myeloproliferative leukemia virus oncogene)-P-selectin axis .
Author Takyar S, Vasavada H, Zhang JG, Ahangari F, Niu N, Liu Q, Lee CG, Cohn L and Elias JA.
Journal J. Exp. Med. 210 (10), 1993-2010 (2013)
Title The association of JAK2V617F mutation and leukocytosis with thrombotic events in essential thrombocythemia .
Author Hsiao HH, Yang MY, Liu YC, Lee CP, Yang WC, Liu TC, Chang CS and Lin SF.
Journal Exp. Hematol. 35 (11), 1704-1707 (2007)
Title Analysis of JAK3, JAK2, and C-MPL mutations in transient myeloproliferative disorder and myeloid leukemia of Down syndrome blasts in children with Down syndrome .
Author Norton,A., Fisher,C., Liu,H., Wen,Q., Mundschau,G., Fuster,J.L., Hasle,H., Zeller,B., Webb,D.K., O'Marcaigh,A., Sorrell,A., Hilden,J., Gamis,A., Crispino,J.D. and Vyas,P.
Journal Blood 110 (3), 1077-1079 (2007)
Title Anaemia characterises patients with myelofibrosis harbouring Mpl mutation .
Author Guglielmelli P, Pancrazzi A, Bergamaschi G, Rosti V, Villani L, Antonioli E, Bosi A, Barosi G and Vannucchi AM.
Journal Br. J. Haematol. 137 (3), 244-247 (2007)
Title Concurrent MPL515 and JAK2V617F mutations in myelofibrosis: chronology of clonal emergence and changes in mutant allele burden over time .
Author Lasho TL, Pardanani A, McClure RF, Mesa RA, Levine RL, Gilliland DG and Tefferi A.
Journal Br. J. Haematol. 135 (5), 683-687 (2006)
Title MPL515 mutations in myeloproliferative and other myeloid disorders: a study of 1182 patients .
Author Pardanani AD, Levine RL, Lasho T, Pikman Y, Mesa RA, Wadleigh M, Steensma DP, Elliott MA, Wolanskyj AP, Hogan WJ, McClure RF, Litzow MR, Gilliland DG and Tefferi A.
Journal Blood 108 (10), 3472-3476 (2006)
Title MPLW515L is a novel somatic activating mutation in myelofibrosis with myeloid metaplasia .
Author Pikman Y, Lee BH, Mercher T, McDowell E, Ebert BL, Gozo M, Cuker A, Wernig G, Moore S, Galinsky I, DeAngelo DJ, Clark JJ, Lee SJ, Golub TR, Wadleigh M, Gilliland DG and Levine RL.
Journal PLoS Med. 3 (7), E270 (2006)
Title Molecular cloning and characterization of MPL, the human homolog of the v-mpl oncogene: identification of a member of the hematopoietic growth factor receptor superfamily .
Author Vigon I, Mornon JP, Cocault L, Mitjavila MT, Tambourin P, Gisselbrecht S and Souyri M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (12), 5640-5644 (1992)
Title A putative truncated cytokine receptor gene transduced by the myeloproliferative leukemia virus immortalizes hematopoietic progenitors .
Author Souyri M, Vigon I, Penciolelli JF, Heard JM, Tambourin P and Wendling F.
Journal Cell 63 (6), 1137-1147 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.