• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.


RefSeq Accession Definition Services Price Order
NM_005408 Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005408.2, 22538799
Length 861 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.
Product C-C motif chemokine 13 precursor
Comment

Summary: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Jul 2008].

RefSeq NP_005399.1
CDS 76..372
Misc Feature(1)49..51
Misc Feature(2)49..51
Misc Feature(3)145..147
Misc Feature(4)151..153
Misc Feature(5)151..153
Misc Feature(6)154..156
Misc Feature(7)154..156
Misc Feature(8)163..165
Misc Feature(9)175..342
Misc Feature(10)order(175..189,193..216,244..249,313..342)
Misc Feature(11)order(181..183,187..189,226..228,232..234,247..249,
Misc Feature(12)order(181..183,187..189,238..240,244..249,265..267,
Misc Feature(13)order(181..183,265..267,292..294)
Misc Feature(14)order(181..189,193..216)
Misc Feature(15)order(187..189,226..228,232..234,262..264,268..270,
Misc Feature(16)order(193..201,208..216,280..282,286..288)
Misc Feature(17)order(232..234,253..255,307..309,313..315,322..327,
Misc Feature(18)244..249
Misc Feature(19)order(274..276,280..282)
Exon (1)1..151
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Exon (2)152..266
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Exon (3)267..851
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Translation MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
65+c, tdbSNP:199632606
88+g, tdbSNP:3136677
102+c, tdbSNP:140451239
114+a, gdbSNP:145325564
161+dbSNP:
161+c, tdbSNP:34566308
192+c, tdbSNP:149285419
282+dbSNP:
282+a, gdbSNP:143510106
314+a, tdbSNP:137918947
346+c, tdbSNP:183253878
347+a, gdbSNP:187454526
460+c, tdbSNP:191543093
577+g, tdbSNP:139142355
598+a, gdbSNP:149499630
669+a, cdbSNP:75348820
672+c, tdbSNP:144148427
693+a, gdbSNP:182653739
745+c, tdbSNP:186581102
797+c, tdbSNP:192522491
806+g, tdbSNP:185659231
Gene SymbolCCL13
Gene SynonymCKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Chromosome17
Locus Map17q11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005408 Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA. Full Length $249.69
ORF Sequence $159.00
Title Estrogen inhibits apoptosis and promotes CC motif chemokine ligand 13 expression on synovial fibroblasts in rheumatoid arthritis .
Author Yamaguchi,A., Nozawa,K., Fujishiro,M., Kawasaki,M., Takamori,K., Ogawa,H., Sekigawa,I. and Takasaki,Y.
Journal Immunopharmacol Immunotoxicol 34 (5), 852-857 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny,E.E., Pe'er,I., Karban,A., Ozelius,L., Mitchell,A.A., Ng,S.M., Erazo,M., Ostrer,H., Abraham,C., Abreu,M.T., Atzmon,G., Barzilai,N., Brant,S.R., Bressman,S., Burns,E.R., Chowers,Y., Clark,L.N., Darvasi,A., Doheny,D., Duerr,R.H., Eliakim,R., Giladi,N., Gregersen,P.K., Hakonarson,H., Jones,M.R., Marder,K., McGovern,D.P., Mulle,J., Orr-Urtreger,A., Proctor,D.D., Pulver,A., Rotter,J.I., Silverberg,M.S., Ullman,T., Warren,S.T., Waterman,M., Zhang,W., Bergman,A., Mayer,L., Katz,S., Desnick,R.J., Cho,J.H. and Peter,I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title Chemokine expression by small sputum macrophages in COPD .
Author Frankenberger,M., Eder,C., Hofer,T.P., Heimbeck,I., Skokann,K., Kassner,G., Weber,N., Moller,W. and Ziegler-Heitbrock,L.
Journal Mol. Med. 17 (7-8), 762-770 (2011)
Title Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' .
Author Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G.
Journal PLoS Genet. 6 (7), E1001016 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title Cloning, in vitro expression, and functional characterization of a novel human CC chemokine of the monocyte chemotactic protein (MCP) family (MCP-4) that binds and signals through the CC chemokine receptor 2B .
Author Berkhout,T.A., Sarau,H.M., Moores,K., White,J.R., Elshourbagy,N., Appelbaum,E., Reape,R.J., Brawner,M., Makwana,J., Foley,J.J., Schmidt,D.B., Imburgia,C., McNulty,D., Matthews,J., O'Donnell,K., O'Shannessy,D., Scott,M., Groot,P.H. and Macphee,C.
Journal J. Biol. Chem. 272 (26), 16404-16413 (1997)
Title Monocyte chemotactic protein-4: tissue-specific expression and signaling through CC chemokine receptor-2 .
Author Godiska,R., Chantry,D., Raport,C.J., Schweickart,V.L., Trong,H.L. and Gray,P.W.
Journal J. Leukoc. Biol. 61 (3), 353-360 (1997)
Title Human monocyte chemoattractant protein (MCP)-4 is a novel CC chemokine with activities on monocytes, eosinophils, and basophils induced in allergic and nonallergic inflammation that signals through the CC chemokine receptors (CCR)-2 and -3 .
Author Garcia-Zepeda,E.A., Combadiere,C., Rothenberg,M.E., Sarafi,M.N., Lavigne,F., Hamid,Q., Murphy,P.M. and Luster,A.D.
Journal J. Immunol. 157 (12), 5613-5626 (1996)
Title A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2 .
Author Naruse,K., Ueno,M., Satoh,T., Nomiyama,H., Tei,H., Takeda,M., Ledbetter,D.H., Coillie,E.V., Opdenakker,G., Gunge,N., Sakaki,Y., Iio,M. and Miura,R.
Journal Genomics 34 (2), 236-240 (1996)
Title Monocyte chemotactic protein 4 (MCP-4), a novel structural and functional analogue of MCP-3 and eotaxin .
Author Uguccioni,M., Loetscher,P., Forssmann,U., Dewald,B., Li,H., Lima,S.H., Li,Y., Kreider,B., Garotta,G., Thelen,M. and Baggiolini,M.
Journal J. Exp. Med. 183 (5), 2379-2384 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878