• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu29848 Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu29848C Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005408.2, 22538799
Length 297 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.
Product C-C motif chemokine 13 precursor
Comment

Summary: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Jul 2008].

RefSeq NP_005399.1
CDS 76..372
Misc Feature(1)49..51
Misc Feature(2)145..147
Misc Feature(3)151..153
Misc Feature(4)151..153
Misc Feature(5)154..156
Misc Feature(6)154..156
Misc Feature(7)163..165
Misc Feature(8)175..342
Misc Feature(9)order(175..189,193..216,244..249,313..342)
Misc Feature(10)order(181..183,187..189,226..228,232..234,247..249,
Misc Feature(11)order(181..183,187..189,238..240,244..249,265..267,
Misc Feature(12)order(181..183,265..267,292..294)
Misc Feature(13)order(181..189,193..216)
Misc Feature(14)order(187..189,226..228,232..234,262..264,268..270,
Misc Feature(15)order(193..201,208..216,280..282,286..288)
Misc Feature(16)order(232..234,253..255,307..309,313..315,322..327,
Misc Feature(17)244..249
Misc Feature(18)order(274..276,280..282)
Exon (1)1..151
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Exon (2)152..266
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Exon (3)267..851
Gene:CCL13
Gene Synonym:CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Translation MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
27+dbSNP:
27+a, gdbSNP:376966664
49+c, tdbSNP:370367733
65+c, tdbSNP:199632606
69+c, tdbSNP:373864188
88+g, tdbSNP:3136677
88+g, tdbSNP:386580192
102+c, tdbSNP:140451239
112+a, cdbSNP:367957184
114+a, gdbSNP:145325564
161+dbSNP:
161+c, tdbSNP:34566308
165+c, gdbSNP:369147614
180+c, tdbSNP:373567305
192+c, tdbSNP:149285419
211+c, tdbSNP:377585122
282+dbSNP:
282+a, gdbSNP:143510106
284+a, gdbSNP:367613739
314+a, tdbSNP:137918947
346+c, tdbSNP:183253878
347+a, gdbSNP:187454526
352+g, tdbSNP:372653174
400+g, tdbSNP:377174787
408+a, gdbSNP:370593553
460+c, tdbSNP:191543093
complement(577)-t, gdbSNP:139142355
598+a, gdbSNP:149499630
618+, tdbSNP:373186520
669+a, cdbSNP:75348820
672+c, tdbSNP:144148427
693+a, gdbSNP:182653739
745+c, tdbSNP:186581102
797+c, tdbSNP:192522491
806+g, tdbSNP:185659231
Gene SymbolCCL13
Gene SynonymCKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Chromosome17
Locus Map17q11.2
Title Correlation of MCP-4 and high-sensitivity C-reactive protein as a marker of inflammation in obesity and chronic periodontitis .
Author Pradeep AR, Kumari M, Kalra N and Priyanka N.
Journal Cytokine 61 (3), 772-777 (2013)
Title Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease .
Author Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K, Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z, Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN, Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A, Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH, Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W, Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M, Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M, Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V, Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD, Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and Cho JH.
Journal Nature 491 (7422), 119-124 (2012)
Title Estrogen inhibits apoptosis and promotes CC motif chemokine ligand 13 expression on synovial fibroblasts in rheumatoid arthritis .
Author Yamaguchi A, Nozawa K, Fujishiro M, Kawasaki M, Takamori K, Ogawa H, Sekigawa I and Takasaki Y.
Journal Immunopharmacol Immunotoxicol 34 (5), 852-857 (2012)
Title A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci .
Author Kenny EE, Pe'er I, Karban A, Ozelius L, Mitchell AA, Ng SM, Erazo M, Ostrer H, Abraham C, Abreu MT, Atzmon G, Barzilai N, Brant SR, Bressman S, Burns ER, Chowers Y, Clark LN, Darvasi A, Doheny D, Duerr RH, Eliakim R, Giladi N, Gregersen PK, Hakonarson H, Jones MR, Marder K, McGovern DP, Mulle J, Orr-Urtreger A, Proctor DD, Pulver A, Rotter JI, Silverberg MS, Ullman T, Warren ST, Waterman M, Zhang W, Bergman A, Mayer L, Katz S, Desnick RJ, Cho JH and Peter I.
Journal PLoS Genet. 8 (3), E1002559 (2012)
Title Chemokine expression by small sputum macrophages in COPD .
Author Frankenberger M, Eder C, Hofer TP, Heimbeck I, Skokann K, Kassner G, Weber N, Moller W and Ziegler-Heitbrock L.
Journal Mol. Med. 17 (7-8), 762-770 (2011)
Title Cloning, in vitro expression, and functional characterization of a novel human CC chemokine of the monocyte chemotactic protein (MCP) family (MCP-4) that binds and signals through the CC chemokine receptor 2B .
Author Berkhout TA, Sarau HM, Moores K, White JR, Elshourbagy N, Appelbaum E, Reape RJ, Brawner M, Makwana J, Foley JJ, Schmidt DB, Imburgia C, McNulty D, Matthews J, O'Donnell K, O'Shannessy D, Scott M, Groot PH and Macphee C.
Journal J. Biol. Chem. 272 (26), 16404-16413 (1997)
Title Monocyte chemotactic protein-4: tissue-specific expression and signaling through CC chemokine receptor-2 .
Author Godiska R, Chantry D, Raport CJ, Schweickart VL, Trong HL and Gray PW.
Journal J. Leukoc. Biol. 61 (3), 353-360 (1997)
Title Human monocyte chemoattractant protein (MCP)-4 is a novel CC chemokine with activities on monocytes, eosinophils, and basophils induced in allergic and nonallergic inflammation that signals through the CC chemokine receptors (CCR)-2 and -3 .
Author Garcia-Zepeda EA, Combadiere C, Rothenberg ME, Sarafi MN, Lavigne F, Hamid Q, Murphy PM and Luster AD.
Journal J. Immunol. 157 (12), 5613-5626 (1996)
Title A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2 .
Author Naruse K, Ueno M, Satoh T, Nomiyama H, Tei H, Takeda M, Ledbetter DH, Coillie EV, Opdenakker G, Gunge N, Sakaki Y, Iio M and Miura R.
Journal Genomics 34 (2), 236-240 (1996)
Title Monocyte chemotactic protein 4 (MCP-4), a novel structural and functional analogue of MCP-3 and eotaxin .
Author Uguccioni M, Loetscher P, Forssmann U, Dewald B, Li H, Lima SH, Li Y, Kreider B, Garotta G, Thelen M and Baggiolini M.
Journal J. Exp. Med. 183 (5), 2379-2384 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.