• THAT   AND
  • THAT   AND


Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_005408 Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA. Full Lenth $249.69
ORF Sequence $159.00


RefSeq Version NM_005408.2, 22538799
Length 861 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens chemokine (C-C motif) ligand 13 (CCL13), mRNA.
Product C-C motif chemokine 13 precursor
Comment

Summary: This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq].

RefSeq NP_005399.1
CDS 76..372
Exon (1)1..151
Exon (2)1..151
Exon (3)152..266
Exon (4)267..851
Translation MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
88+g, tdbSNP:3136677
complement(161)-t, cdbSNP:34566308
669+a, cdbSNP:75348820
673+a, gdbSNP:117476070
Gene SymbolCCL13
Gene SynonymCKb10; MCP-4; MGC17134; NCC-1; NCC1; SCYA13; SCYL1
Chromosome17
Locus Map17q11.2
All Transcripts NM_005408
Title Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility 'hot-spot' .
Author Johnatty,S.E., Beesley,J., Chen,X., Macgregor,S., Duffy,D.L., Spurdle,A.B., deFazio,A., Gava,N., Webb,P.M., Rossing,M.A., Doherty,J.A., Goodman,M.T., Lurie,G., Thompson,P.J., Wilkens,L.R., Ness,R.B., Moysich,K.B., Chang-Claude,J., Wang-Gohrke,S., Cramer,D.W., Terry,K.L., Hankinson,S.E., Tworoger,S.S., Garcia-Closas,M., Yang,H., Lissowska,J., Chanock,S.J., Pharoah,P.D., Song,H., Whitemore,A.S., Pearce,C.L., Stram,D.O., Wu,A.H., Pike,M.C., Gayther,S.A., Ramus,S.J., Menon,U., Gentry-Maharaj,A., Anton-Culver,H., Ziogas,A., Hogdall,E., Kjaer,S.K., Hogdall,C., Berchuck,A., Schildkraut,J.M., Iversen,E.S., Moorman,P.G., Phelan,C.M., Sellers,T.A., Cunningham,J.M., Vierkant,R.A., Rider,D.N., Goode,E.L., Haviv,I. and Chenevix-Trench,G.
Journal PLoS Genet. 6 (7), E1001016 (2010)
Title Polymorphisms in innate immunity genes and risk of childhood leukemia .
Author Han,S., Lan,Q., Park,A.K., Lee,K.M., Park,S.K., Ahn,H.S., Shin,H.Y., Kang,H.J., Koo,H.H., Seo,J.J., Choi,J.E., Ahn,Y.O., Chanock,S.J., Kim,H., Rothman,N. and Kang,D.
Journal Hum. Immunol. 71 (7), 727-730 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof,A., Bont,L., Siezen,C.L., Hodemaekers,H., van Houwelingen,H.C., Kimman,T.G., Hoebee,B., Kimpen,J.L. and Janssen,R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title Risk of meningioma and common variation in genes related to innate immunity .
Author Rajaraman,P., Brenner,A.V., Neta,G., Pfeiffer,R., Wang,S.S., Yeager,M., Thomas,G., Fine,H.A., Linet,M.S., Rothman,N., Chanock,S.J. and Inskip,P.D.
Journal Cancer Epidemiol. Biomarkers Prev. 19 (5), 1356-1361 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Cloning, in vitro expression, and functional characterization of a novel human CC chemokine of the monocyte chemotactic protein (MCP) family (MCP-4) that binds and signals through the CC chemokine receptor 2B .
Author Berkhout,T.A., Sarau,H.M., Moores,K., White,J.R., Elshourbagy,N., Appelbaum,E., Reape,R.J., Brawner,M., Makwana,J., Foley,J.J., Schmidt,D.B., Imburgia,C., McNulty,D., Matthews,J., O'Donnell,K., O'Shannessy,D., Scott,M., Groot,P.H. and Macphee,C.
Journal J. Biol. Chem. 272 (26), 16404-16413 (1997)
Title Monocyte chemotactic protein-4: tissue-specific expression and signaling through CC chemokine receptor-2 .
Author Godiska,R., Chantry,D., Raport,C.J., Schweickart,V.L., Trong,H.L. and Gray,P.W.
Journal J. Leukoc. Biol. 61 (3), 353-360 (1997)
Title Human monocyte chemoattractant protein (MCP)-4 is a novel CC chemokine with activities on monocytes, eosinophils, and basophils induced in allergic and nonallergic inflammation that signals through the CC chemokine receptors (CCR)-2 and -3 .
Author Garcia-Zepeda,E.A., Combadiere,C., Rothenberg,M.E., Sarafi,M.N., Lavigne,F., Hamid,Q., Murphy,P.M. and Luster,A.D.
Journal J. Immunol. 157 (12), 5613-5626 (1996)
Title A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2 .
Author Naruse,K., Ueno,M., Satoh,T., Nomiyama,H., Tei,H., Takeda,M., Ledbetter,D.H., Coillie,E.V., Opdenakker,G., Gunge,N., Sakaki,Y., Iio,M. and Miura,R.
Journal Genomics 34 (2), 236-240 (1996)
Title Monocyte chemotactic protein 4 (MCP-4), a novel structural and functional analogue of MCP-3 and eotaxin .
Author Uguccioni,M., Loetscher,P., Forssmann,U., Dewald,B., Li,H., Lima,S.H., Li,Y., Kreider,B., Garotta,G., Thelen,M. and Baggiolini,M.
Journal J. Exp. Med. 183 (5), 2379-2384 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878