• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tectorin alpha (TECTA), mRNA.


RefSeq Accession Definition Services Price Order
NM_005422 Homo sapiens tectorin alpha (TECTA), mRNA. ORF Sequence $2910.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_005422.2, 134268639
Length 6468 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tectorin alpha (TECTA), mRNA.
Product alpha-tectorin precursor
Comment

Summary: The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments and orthologous data.

RefSeq NP_005413.2
CDS 1..6468
Misc Feature(1)292..762
Misc Feature(2)964..1434
Misc Feature(3)1549..1773
Misc Feature(4)1789..1950
Misc Feature(5)1954..2118
Misc Feature(6)2107..2595
Misc Feature(7)2713..2943
Misc Feature(8)2950..3108
Misc Feature(9)3298..3771
Misc Feature(10)3880..4104
Misc Feature(11)4114..4275
Misc Feature(12)4279..4440
Misc Feature(13)4429..4914
Misc Feature(14)5050..5274
Misc Feature(15)5413..6171
Exon (1)65..198
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (2)199..486
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (3)487..624
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (4)625..790
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (5)791..1203
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (6)1204..1774
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (7)1775..2367
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (8)2368..2941
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (9)2942..3543
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (10)3544..4105
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (11)4106..4305
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (12)4306..4689
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (13)4690..4976
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (14)4977..5272
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (15)5273..5383
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (16)5384..5586
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (17)5587..5750
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (18)5751..5999
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (19)6000..6162
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (20)6163..6250
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (21)6251..6367
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Exon (22)6368..6468
Gene:TECTA
Gene Synonym:DFNA12; DFNA8; DFNB21
Translation MNYSSFLRIWVSFIFALVQHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGV PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFVAPFWADVHNGIRGEIYYRETMEPA ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPEIVNIQETTNVN VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTVKCRCLDFNNEIYCQEASCS PYEVCEPKGKFFYCSAVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF FSVEAKNEHRRGSAVSWVKELSVEVNGYKILIPKGSYGRVKVNDLVTSLPVTLDLGTVKI YQSGISTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA MSVLDLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVQCPSF SHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNQGFVLSTSQCVPLHKCGCDFDGHYYT MGEFFWATANCTVQCLCEEGGDVYCFNKTCGSGEVCAVEDGYQGCFPKRETVCLLSQNQV LHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKI GGIGASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESKGVVTVQYSDIGLLYIRLSTT YFNCTGGLCGFYNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARY ASACKNADVEVGPWRTYDFCPLECPENSHFEECITCTETCETLTLGPICVDSCSEGCQCD EGYALLGSQCVTRSECGCNFEGHQLATNETFWVDLDCQIFCYCSGTDNRVHCETIPCKDD EYCMEEGGLYYCQARTDASCIVSGYGHYLTFDGFPFDFQTSCPLILCTTGSRPSSDSFPK FVVTAKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINI FSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPMGLLA SSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAAFSKCHSKVNP TFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGITVTGWRNYTSCTVTCPPNSHYES CVSVCQPRCAAIRLKSDCSHYCVEGCHCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLF WNSDCTRRCRCFRRNVIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDG AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIISPVYFYINEEQILINDRN TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG LCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKRPLAPSCNELQFSQYAAMCDNV HIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYSHKKFQLCGSLAAYGEA CRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDII DAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNI VQSNGTHIMYKNTLWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVIN LTVPTQEGSFITKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADATHLILTLNKC YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHC AVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTS RVDGPLCSCVTGTLQEDGKSCRASNSSMELQVWTLLLIMIQISLWHFVYKSGTTS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33+dbSNP:
33+a, cdbSNP:140393508
46+c, gdbSNP:149919658
56+a, gdbSNP:35507522
240+dbSNP:
240+c, tdbSNP:142064539
248+c, tdbSNP:145898158
281+c, gdbSNP:202088899
286+a, gdbSNP:138646574
420+c, tdbSNP:141090151
437+c, tdbSNP:143458087
552+dbSNP:
552+c, tdbSNP:148364865
668+dbSNP:
668+a, cdbSNP:141580993
669+a, gdbSNP:150877023
680+a, cdbSNP:138438027
684+c, gdbSNP:142838739
685+a, gdbSNP:150098939
690+c, tdbSNP:34605023
696+c, tdbSNP:149758927
701+a, gdbSNP:144682235
706+a, gdbSNP:200752577
714+c, tdbSNP:148478527
728+a, gdbSNP:112943216
762+a, tdbSNP:142743467
803+dbSNP:
803+a, gdbSNP:147609795
806+a, gdbSNP:199692947
808+c, gdbSNP:200001522
841+a, gdbSNP:142205703
878+a, gdbSNP:185351501
894+c, tdbSNP:140392725
938+a, gdbSNP:144429489
972+c, gdbSNP:147790742
1002+c, tdbSNP:35282525
1003+a, gdbSNP:150286595
1013+c, tdbSNP:201571492
1028+c, tdbSNP:201086820
1049+a, gdbSNP:137951168
1085+g, tdbSNP:149001418
1089+g, tdbSNP:145913741
1111+a, gdbSNP:612969
1117+a, tdbSNP:111928830
1127+c, tdbSNP:181889512
1177+c, tdbSNP:142926325
1241+dbSNP:
1241+a, tdbSNP:146123488
1247+a, gdbSNP:186922301
1291+a, tdbSNP:138843691
1306+c, tdbSNP:114848608
1320+c, tdbSNP:141488594
1351+a, gdbSNP:150823097
1391+a, gdbSNP:139269834
1425+a, gdbSNP:149533095
1436+c, tdbSNP:35107075
1437+a, gdbSNP:140634094
1443+a, gdbSNP:144362937
1461+a, gdbSNP:202127508
1485+c, tdbSNP:536069
1502+c, tdbSNP:148426950
1509+c, tdbSNP:61733565
1531+a, gdbSNP:150927084
1579+c, tdbSNP:140669621
1608+a, gdbSNP:201454777
1647+c, tdbSNP:201949975
1651+a, gdbSNP:200857366
1686+a, gdbSNP:144615423
1717+c, gdbSNP:187272498
1745+c, tdbSNP:200458050
1757+a, gdbSNP:146621940
1772+a, gdbSNP:141434625
1812+dbSNP:
1812+c, tdbSNP:138914618
1814+g, tdbSNP:149372138
1834+a, gdbSNP:143730090
1861+c, tdbSNP:200535910
1884+a, gdbSNP:148118238
1919+c, gdbSNP:201153452
1962+c, tdbSNP:143808255
1968+a, cdbSNP:147246652
2016+c, tdbSNP:140569889
2044+g, tdbSNP:142935702
2046+c, gdbSNP:147404112
2061+c, gdbSNP:139165033
2077+a, gdbSNP:200502160
2089+a, gdbSNP:149935047
2123+a, gdbSNP:144932466
2140+a, gdbSNP:2155366
2184+c, tdbSNP:148638616
2237+a, gdbSNP:143120527
2256+c, tdbSNP:10502247
2266+a, gdbSNP:141420954
2267+a, gdbSNP:145176230
2268+a, gdbSNP:200686885
2284+a, gdbSNP:113683942
2288+c, tdbSNP:151296951
2299+a, cdbSNP:140534420
2302+a, gdbSNP:202016102
2322+c, tdbSNP:200749722
2358+a, gdbSNP:145498566
2408+dbSNP:
2408+c, tdbSNP:150462448
2418+a, gdbSNP:138185038
2442+a, tdbSNP:143919294
2444+c, tdbSNP:111759871
2487+c, tdbSNP:139085765
2507+a, gdbSNP:142869679
2511+a, gdbSNP:201725913
2520+a, gdbSNP:201271587
2544+a, gdbSNP:144582229
2547+c, tdbSNP:148065839
2548+a, gdbSNP:145520014
2566+a, g, tdbSNP:145413004
2574+c, tdbSNP:150564356
2575+a, gdbSNP:192787819
2604+g, tdbSNP:139509847
2622+a, cdbSNP:148784853
2638+a, gdbSNP:143315827
2657+a, gdbSNP:146175803
2725+c, tdbSNP:139132568
2737+a, gdbSNP:143998942
2745+c, tdbSNP:61733566
2749+a, gdbSNP:145852265
2775+a, gdbSNP:201183523
2778+c, tdbSNP:149008453
2781..2782+, gdbSNP:34851638
2781+c, tdbSNP:142903119
2794+c, gdbSNP:200340759
2795+a, gdbSNP:520805
2805+a, gdbSNP:586473
2824+c, tdbSNP:146611460
2827+a, cdbSNP:139158022
2841+a, gdbSNP:141514646
2875+c, tdbSNP:186684402
2876+a, gdbSNP:150403193
2886+c, tdbSNP:138065050
2900+c, tdbSNP:199688655
2901+a, gdbSNP:149546608
2905+a, gdbSNP:191801082
2907+c, gdbSNP:144033961
2923+c, tdbSNP:138696978
2945+dbSNP:
2945+c, tdbSNP:141616288
2967+a, cdbSNP:200821009
3006+c, gdbSNP:146203161
3012+c, gdbSNP:61291716
3097+c, tdbSNP:142486386
3100+a, tdbSNP:180756361
3103+a, gdbSNP:150512674
3121+g, tdbSNP:79623228
3169+a, tdbSNP:121909059
3217+a, gdbSNP:139732688
3222+c, gdbSNP:186701090
3225..3226+, cdbSNP:34501423
3243+a, gdbSNP:150074181
3304+a, gdbSNP:34658230
3314+a, cdbSNP:75306925
3315+c, tdbSNP:142573400
3317+a, gdbSNP:144844263
3406+c, gdbSNP:147890616
3492+c, tdbSNP:144012985
3511+a, gdbSNP:186780639
3521+c, gdbSNP:143649634
3556+dbSNP:
3556+c, tdbSNP:148098950
3574+a, cdbSNP:200187036
3589+a, gdbSNP:71486353
3673+c, gdbSNP:201018808
3674+a, tdbSNP:201854431
3704+a, gdbSNP:200852252
3718+c, gdbSNP:200272533
3727+c, tdbSNP:140869937
3735+c, tdbSNP:150175313
3736+a, gdbSNP:200218954
3742+c, tdbSNP:202223574
3743+c, tdbSNP:138768918
3791+a, gdbSNP:200871280
3837+a, gdbSNP:201418505
3851+a, gdbSNP:141717375
3871+g, tdbSNP:145456927
3896+a, gdbSNP:137916023
3958+c, tdbSNP:149494818
3971+a, gdbSNP:143871832
4004+a, gdbSNP:148619105
4011+a, gdbSNP:144441070
4020+c, tdbSNP:147318195
4045+a, gdbSNP:141024429
4061+c, tdbSNP:148440178
4074+a, gdbSNP:141674508
4085+a, gdbSNP:199638531
4097+c, tdbSNP:201860044
4098+a, gdbSNP:12275038
4134+dbSNP:
4134+c, tdbSNP:139303865
4144+g, tdbSNP:199637730
4163+a, gdbSNP:150016625
4170+c, tdbSNP:199846936
4178+a, gdbSNP:201554148
4197+c, tdbSNP:145177862
4207+g, tdbSNP:200563210
4236+c, tdbSNP:149128713
4260+c, gdbSNP:200739678
4276+a, gdbSNP:143250687
4315+dbSNP:
4315+a, cdbSNP:202199158
4317+a, cdbSNP:146742726
4337+c, gdbSNP:72998913
4422+c, tdbSNP:33981325
4441+a, gdbSNP:201946991
4449+a, gdbSNP:145445097
4480+a, gdbSNP:199751471
4481+c, tdbSNP:200544452
4533+c, tdbSNP:77628498
4561+c, tdbSNP:201498689
4581+c, tdbSNP:141671561
4594+a, gdbSNP:199809873
4605+a, gdbSNP:140560140
4607+c, tdbSNP:150123288
4611+c, tdbSNP:138477419
4683+c, gdbSNP:149232569
4720+dbSNP:
4720+a, gdbSNP:147354818
4751+c, gdbSNP:34963131
4776+c, tdbSNP:143362062
4788+c, tdbSNP:150561147
4794+a, gdbSNP:148568082
4813+a, gdbSNP:201952240
4856+c, gdbSNP:121909060
4858+a, gdbSNP:142929996
4869+c, tdbSNP:138780217
4878+c, tdbSNP:151056317
4909+c, tdbSNP:139782546
4919+c, tdbSNP:143546623
4932+c, tdbSNP:201375747
4944+c, tdbSNP:200019166
4965+c, tdbSNP:200769761
4988+dbSNP:
4988+c, tdbSNP:199924193
5012+c, tdbSNP:142948530
5046+c, tdbSNP:200367148
5049+g, tdbSNP:140402847
5091+a, gdbSNP:200028435
5108+c, tdbSNP:201114773
5131+c, tdbSNP:202144744
5142+c, tdbSNP:151087951
5160+c, tdbSNP:142657158
5161+a, gdbSNP:146481835
5163+c, tdbSNP:144173474
5171+c, tdbSNP:526433
5206+a, gdbSNP:144946579
5233+a, gdbSNP:201488025
5273+dbSNP:
5273+c, tdbSNP:199705973
5301+a, gdbSNP:143133132
5432..5433+dbSNP:
5432..5433+, gdbSNP:36019466
5451+a, gdbSNP:201029860
5452+g, tdbSNP:148209145
5458+c, tdbSNP:281865415
5471+a, gdbSNP:267607107
5487+c, tdbSNP:200987442
5488+a, gdbSNP:189181502
5509+c, g, tdbSNP:121909061
5597+dbSNP:
5597+c, tdbSNP:140236996
5598+a, gdbSNP:146930070
5609+a, gdbSNP:121909058
5632+a, cdbSNP:202045605
5634+a, c, gdbSNP:2155369
5668+c, tdbSNP:121909063
5672+c, tdbSNP:200977539
5733+a, cdbSNP:516678
5754+dbSNP:
5754+a, tdbSNP:147526966
5761+c, tdbSNP:138338177
5766+a, gdbSNP:149602974
5836+c, tdbSNP:144343770
5840+a, gdbSNP:202104412
5877+c, gdbSNP:148742094
5908+a, gdbSNP:202079138
5913+a, tdbSNP:200655923
5978+a, gdbSNP:199881827
5990+c, tdbSNP:143748991
6034+dbSNP:
6034+a, gdbSNP:146295586
6051+c, tdbSNP:200930738
6052+c, tdbSNP:57903285
6055+a, gdbSNP:112647833
6062+a, gdbSNP:121909062
6100+a, gdbSNP:202092043
6135+c, tdbSNP:139552118
6162+c, tdbSNP:140608882
6201+dbSNP:
6201+a, gdbSNP:151002895
6252+dbSNP:
6252+g, tdbSNP:140887380
6296+c, tdbSNP:149716373
6297+c, gdbSNP:145589648
6302+a, gdbSNP:201454201
6402+dbSNP:
6402+a, g, tdbSNP:141203939
6458+c, tdbSNP:146965680
Gene SymbolTECTA
Gene SynonymDFNA12; DFNA8; DFNB21
Chromosome11
Locus Map11q22-q24
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_005422 Homo sapiens tectorin alpha (TECTA), mRNA. Full Length $2910.60
ORF Sequence $2910.60
Title Aberrant transcript produced by a splice donor site deletion in the .
Author Lezirovitz,K., Batissoco,A.C., Lima,F.T., Auricchio,M.T., Nonose,R.W., dos Santos,S.R., Guilherme,L., Oiticica,J. and Mingroni-Netto,R.C.
Journal Gene 511 (2), 280-284 (2012)
Title TECTA mutations in Japanese with mid-frequency hearing loss affected by zona pellucida domain protein secretion .
Author Moteki,H., Nishio,S.Y., Hashimoto,S., Takumi,Y., Iwasaki,S., Takeichi,N., Fukuda,S. and Usami,S.
Journal J. Hum. Genet. 57 (9), 587-592 (2012)
Title Loss of mammal-specific tectorial membrane component carcinoembryonic antigen cell adhesion molecule 16 (CEACAM16) leads to hearing impairment at low and high frequencies .
Author Kammerer,R., Ruttiger,L., Riesenberg,R., Schauble,C., Krupar,R., Kamp,A., Sunami,K., Eisenried,A., Hennenberg,M., Grunert,F., Bress,A., Battaglia,S., Schrewe,H., Knipper,M., Schneider,M.R. and Zimmermann,W.
Journal J. Biol. Chem. 287 (26), 21584-21598 (2012)
Title Identification and functional characterization of novel compound heterozygotic mutations in the TECTA gene .
Author Sagong,B., Park,H.J., Lee,K.Y. and Kim,U.K.
Journal Gene 492 (1), 239-243 (2012)
Title DFNA8/12 caused by TECTA mutations is the most identified subtype of nonsyndromic autosomal dominant hearing loss .
Author Hildebrand,M.S., Morin,M., Meyer,N.C., Mayo,F., Modamio-Hoybjor,S., Mencia,A., Olavarrieta,L., Morales-Angulo,C., Nishimura,C.J., Workman,H., DeLuca,A.P., del Castillo,I., Taylor,K.R., Tompkins,B., Goodman,C.W., Schrauwen,I., Wesemael,M.V., Lachlan,K., Shearer,A.E., Braun,T.A., Huygen,P.L., Kremer,H., Van Camp,G., Moreno,F., Casavant,T.L., Smith,R.J. and Moreno-Pelayo,M.A.
Journal Hum. Mutat. 32 (7), 825-834 (2011)
Title Evidence for digenic inheritance of nonsyndromic hereditary hearing loss in a Swedish family .
Author Balciuniene,J., Dahl,N., Borg,E., Samuelsson,E., Koisti,M.J., Pettersson,U. and Jazin,E.E.
Journal Am. J. Hum. Genet. 63 (3), 786-793 (1998)
Title Mutations in the human alpha-tectorin gene cause autosomal dominant non-syndromic hearing impairment .
Author Verhoeven,K., Van Laer,L., Kirschhofer,K., Legan,P.K., Hughes,D.C., Schatteman,I., Verstreken,M., Van Hauwe,P., Coucke,P., Chen,A., Smith,R.J., Somers,T., Offeciers,F.E., Van de Heyning,P., Richardson,G.P., Wachtler,F., Kimberling,W.J., Willems,P.J., Govaerts,P.J. and Van Camp,G.
Journal Nat. Genet. 19 (1), 60-62 (1998)
Title Mapping of the alpha-tectorin gene (TECTA) to mouse chromosome 9 and human chromosome 11: a candidate for human autosomal dominant nonsyndromic deafness .
Author Hughes,D.C., Legan,P.K., Steel,K.P. and Richardson,G.P.
Journal Genomics 48 (1), 46-51 (1998)
Title A gene for autosomal dominant nonsyndromic hearing loss (DFNA12) maps to chromosome 11q22-24 .
Author Verhoeven,K., Van Camp,G., Govaerts,P.J., Balemans,W., Schatteman,I., Verstreken,M., Van Laer,L., Smith,R.J., Brown,M.R., Van de Heyning,P.H., Somers,T., Offeciers,F.E. and Willems,P.J.
Journal Am. J. Hum. Genet. 60 (5), 1168-1173 (1997)
Title Nonsyndromic hearing impairment: unparalleled heterogeneity .
Author Van Camp,G., Willems,P.J. and Smith,R.J.
Journal Am. J. Hum. Genet. 60 (4), 758-764 (1997)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878