• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens noggin (NOG), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005450 Homo sapiens noggin (NOG), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 TBD

*Business Day

Related Services

RefSeq Version NM_005450.4, 189339247
Length 1892 bp
Structure linear
Update Date 10-MAR-2013
Organism Homo sapiens (human)
Definition Homo sapiens noggin (NOG), mRNA.
Product noggin precursor
Comment

Summary: The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_005441.1
CDS 526..1224
Misc Feature(1)103..105
Misc Feature(2)103..105
Misc Feature(3)550..1221
Misc Feature(4)709..711
Misc Feature(5)order(1144..1146,1168..1170)
Exon (1)1..1892
Gene:NOG
Gene Synonym:SYM1; SYNS1
Translation MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
141+a, cdbSNP:117249328
453+a, gdbSNP:183274390
543+, cdbSNP:34711886
593+c, tdbSNP:138776675
595+c, tdbSNP:200253265
628+c, g, tdbSNP:28937580
629+c, gdbSNP:104894611
695+a, gdbSNP:149382085
703+a, gdbSNP:117165670
733+c, tdbSNP:200290354
739+a, gdbSNP:147499492
776+a, cdbSNP:138481449
800+a, gdbSNP:199566527
853+c, tdbSNP:104894614
911+a, tdbSNP:104894613
973+g, tdbSNP:200203403
1024+c, gdbSNP:121908949
1076+a, gdbSNP:104894612
1086+c, tdbSNP:202015803
1090+g, tdbSNP:104894609
1107+a, gdbSNP:76347008
1116+c, gdbSNP:147334594
1136+g, tdbSNP:104894610
1140+c, gdbSNP:104894615
1174+g, tdbSNP:104894603
1189+g, tdbSNP:121908948
1190+a, gdbSNP:104894602
1193+c, tdbSNP:104894608
1304+g, tdbSNP:1442829
1334..1335+, tttttdbSNP:71888945
1334+a, gdbSNP:1236187
1334+, ttdbSNP:71139919
1345+, tt, ttttttdbSNP:67555616
1362+c, gdbSNP:199614572
1377+a, gdbSNP:74256715
1430+a, gdbSNP:139325910
1527+g, tdbSNP:1348322
1532+, adbSNP:144715174
1791+c, gdbSNP:116716909
1830+a, gdbSNP:187913874
Gene SymbolNOG
Gene SynonymSYM1; SYNS1
Chromosome17
Locus Map17q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005450 Homo sapiens noggin (NOG), mRNA. In-stock $308.00 $259.00 TBD
Title Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro .
Author Chen,C., Uludag,H., Wang,Z. and Jiang,H.
Journal J. Cell. Biochem. 113 (12), 3672-3680 (2012)
Title BMP2 induces osteoblast apoptosis in a maturation state and noggin-dependent manner .
Author Hyzy,S.L., Olivares-Navarrete,R., Schwartz,Z. and Boyan,B.D.
Journal J. Cell. Biochem. 113 (10), 3236-3245 (2012)
Title Identification of NOG as a specific breast cancer bone metastasis-supporting gene .
Author Tarragona,M., Pavlovic,M., Arnal-Estape,A., Urosevic,J., Morales,M., Guiu,M., Planet,E., Gonzalez-Suarez,E. and Gomis,R.R.
Journal J. Biol. Chem. 287 (25), 21346-21355 (2012)
Title Myo/Nog cells in normal, wounded and tumor-bearing skin .
Author Gerhart,J., Hayes,C., Scheinfeld,V., Chernick,M., Gilmour,S. and George-Weinstein,M.
Journal Exp. Dermatol. 21 (6), 466-468 (2012)
Title Functional analysis of alleged NOGGIN mutation G92E disproves its pathogenic relevance .
Author Zimmer,J., Doelken,S.C., Horn,D., Groppe,J.C., Shore,E.M., Kaplan,F.S. and Seemann,P.
Journal PLoS ONE 7 (4), E35062 (2012)
Title Noggin-mediated antagonism of BMP signaling is required for growth and patterning of the neural tube and somite .
Author McMahon,J.A., Takada,S., Zimmerman,L.B., Fan,C.M., Harland,R.M. and McMahon,A.P.
Journal Genes Dev. 12 (10), 1438-1452 (1998)
Title The Spemann organizer signal noggin binds and inactivates bone morphogenetic protein 4 .
Author Zimmerman,L.B., De Jesus-Escobar,J.M. and Harland,R.M.
Journal Cell 86 (4), 599-606 (1996)
Title Fibroblast growth factor is a direct neural inducer, which combined with noggin generates anterior-posterior neural pattern .
Author Lamb,T.M. and Harland,R.M.
Journal Development 121 (11), 3627-3636 (1995)
Title Identification of mammalian noggin and its expression in the adult nervous system .
Author Valenzuela,D.M., Economides,A.N., Rojas,E., Lamb,T.M., Nunez,L., Jones,P., Lp,N.Y., Espinosa,R. III, Brannan,C.I., Gilbert,D.J. et al.
Journal J. Neurosci. 15 (9), 6077-6084 (1995)
Title Localization of the gene (SYM1) for proximal symphalangism to human chromosome 17q21-q22 .
Author Polymeropoulos,M.H., Poush,J., Rubenstein,J.R. and Francomano,C.A.
Journal Genomics 27 (2), 225-229 (1995)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.