• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens noggin (NOG), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19429 Homo sapiens noggin (NOG), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19429C Homo sapiens noggin (NOG), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005450.4, 189339247
Length 699 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens noggin (NOG), mRNA.
Product noggin precursor
Comment

Summary: The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients. The protein appears to have pleiotropic effect, both early in development as well as in later stages. It was originally isolated from Xenopus based on its ability to restore normal dorsal-ventral body axis in embryos that had been artificially ventralized by UV treatment. The results of the mouse knockout of the ortholog suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. Recently, several dominant human NOG mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) were identified; both SYM1 and SYNS1 have multiple joint fusion as their principal feature, and map to the same region (17q22) as this gene. All of these mutations altered evolutionarily conserved amino acid residues. The amino acid sequence of this human gene is highly homologous to that of Xenopus, rat and mouse. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_005441.1
CDS 526..1224
Misc Feature(1)103..105
Misc Feature(2)103..105
Misc Feature(3)550..1221
Misc Feature(4)709..711
Misc Feature(5)order(1144..1146,1168..1170)
Exon (1)1..1892
Gene:NOG
Gene Synonym:SYM1; SYNS1
Translation MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
117+c, tdbSNP:368706409
141+a, cdbSNP:117249328
453+a, gdbSNP:183274390
544+, cdbSNP:34711886
545+g, tdbSNP:377157982
593+c, tdbSNP:138776675
595+c, tdbSNP:200253265
628+c, g, tdbSNP:28937580
629+c, gdbSNP:104894611
652+c, gdbSNP:372535983
659+a, gdbSNP:373452045
703+a, gdbSNP:117165670
733+c, tdbSNP:200290354
739+a, gdbSNP:147499492
776+a, cdbSNP:138481449
792+a, cdbSNP:376069726
797+c, gdbSNP:375026622
800+a, gdbSNP:199566527
833+a, tdbSNP:373305050
853+c, tdbSNP:104894614
863+c, tdbSNP:371150691
911+a, tdbSNP:104894613
929+a, gdbSNP:375219346
950+a, gdbSNP:369585713
973+g, tdbSNP:200203403
1024+c, gdbSNP:121908949
1076+a, gdbSNP:104894612
1081+g, tdbSNP:372604336
1086+c, tdbSNP:202015803
1090+g, tdbSNP:104894609
1101+c, tdbSNP:375586586
1107+a, gdbSNP:76347008
1116+c, gdbSNP:147334594
1136+g, tdbSNP:104894610
1140+c, gdbSNP:104894615
1143+c, tdbSNP:370397639
1174+g, tdbSNP:104894603
1189+g, tdbSNP:121908948
1190+a, gdbSNP:104894602
1193+c, tdbSNP:104894608
1221+c, gdbSNP:387906844
1229+c, tdbSNP:374850006
1304+g, tdbSNP:1442829
complement(1334)-g, adbSNP:1236187
1334+c, tdbSNP:386523929
1358..1359+, ttdbSNP:71139919
1362+c, gdbSNP:199614572
1377+a, gdbSNP:74256715
1430+a, gdbSNP:139325910
complement(1527)-t, gdbSNP:1348322
1532+, adbSNP:144715174
1679+c, tdbSNP:367951499
1791+c, gdbSNP:116716909
1830+a, gdbSNP:187913874
Gene SymbolNOG
Gene SynonymSYM1; SYNS1
Chromosome17
Locus Map17q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005450 Homo sapiens noggin (NOG), mRNA. In-stock $99.00 TBD
Title An introduction of genetics in otosclerosis: a systematic review .
Author Bittermann AJ, Wegner I, Noordman BJ, Vincent R, van der Heijden GJ and Grolman W.
Journal Otolaryngol Head Neck Surg 150 (1), 34-39 (2014)
Title Multiple synostoses syndrome in three members of a family displaying a novel mutation in NOGGIN gene .
Author Aydin,H.U., Altunoglu,U., Uyguner,Z.O., Ozkan,T. and Kayserili,H.
Journal J Plast Reconstr Aesthet Surg 66 (10), E287-E289 (2013)
Title A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease .
Author Ostensson M, Monten C, Bacelis J, Gudjonsdottir AH, Adamovic S, Ek J, Ascher H, Pollak E, Arnell H, Browaldh L, Agardh D, Wahlstrom J, Nilsson S and Torinsson-Naluai A.
Journal PLoS ONE 8 (8), E70174 (2013)
Title The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues .
Author Laurila R, Parkkila S, Isola J, Kallioniemi A and Alarmo EL.
Journal Int J Clin Exp Pathol 6 (7), 1400-1408 (2013)
Title Noggin attenuates the osteogenic activation of human valve interstitial cells in aortic valve sclerosis .
Author Poggio P, Sainger R, Branchetti E, Grau JB, Lai EK, Gorman RC, Sacks MS, Parolari A, Bavaria JE and Ferrari G.
Journal Cardiovasc. Res. 98 (3), 402-410 (2013)
Title Noggin-mediated antagonism of BMP signaling is required for growth and patterning of the neural tube and somite .
Author McMahon JA, Takada S, Zimmerman LB, Fan CM, Harland RM and McMahon AP.
Journal Genes Dev. 12 (10), 1438-1452 (1998)
Title The Spemann organizer signal noggin binds and inactivates bone morphogenetic protein 4 .
Author Zimmerman LB, De Jesus-Escobar JM and Harland RM.
Journal Cell 86 (4), 599-606 (1996)
Title Fibroblast growth factor is a direct neural inducer, which combined with noggin generates anterior-posterior neural pattern .
Author Lamb TM and Harland RM.
Journal Development 121 (11), 3627-3636 (1995)
Title Identification of mammalian noggin and its expression in the adult nervous system .
Author Valenzuela DM, Economides AN, Rojas E, Lamb TM, Nunez L, Jones P, Lp NY, Espinosa R 3rd, Brannan CI and Gilbert DJ.
Journal J. Neurosci. 15 (9), 6077-6084 (1995)
Title Localization of the gene (SYM1) for proximal symphalangism to human chromosome 17q21-q22 .
Author Polymeropoulos MH, Poush J, Rubenstein JR and Francomano CA.
Journal Genomics 27 (2), 225-229 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.