• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 4 (HCN4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005477 Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 4 (HCN4), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_005477.2, 210147528
Length 7245 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 4 (HCN4), mRNA.
Product potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
Comment

Summary: This gene encodes a member of the hyperpolarization-activated cyclic nucleotide-gated potassium channels. The encoded protein shows slow kinetics of activation and inactivation, and is necessary for the cardiac pacemaking process. This channel may also mediate responses to sour stimuli. Mutations in this gene have been linked to sick sinus syndrome 2, also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. Two pseudogenes have been identified on chromosome 15. [provided by RefSeq, Oct 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_005468.1
CDS 995..4606
Misc Feature(1)866..868
Misc Feature(2)1619..1774
Misc Feature(3)1619..1774
Misc Feature(4)1643..1873
Misc Feature(5)1793..1855
Misc Feature(6)1874..1936
Misc Feature(7)1883..2527
Misc Feature(8)2015..2077
Misc Feature(9)2099..2161
Misc Feature(10)2255..2317
Misc Feature(11)2483..2545
Misc Feature(12)2759..>3166
Misc Feature(13)2777..3103
Misc Feature(14)order(2969..2974,2999..3007)
Misc Feature(15)order(3065..3073,3083..3091)
Exon (1)1..1779
Gene:HCN4
Gene Synonym:SSS2
Exon (2)1780..2203
Gene:HCN4
Gene Synonym:SSS2
Exon (3)2204..2365
Gene:HCN4
Gene Synonym:SSS2
Exon (4)2366..2584
Gene:HCN4
Gene Synonym:SSS2
Exon (5)2585..2731
Gene:HCN4
Gene Synonym:SSS2
Exon (6)2732..2972
Gene:HCN4
Gene Synonym:SSS2
Exon (7)2973..3137
Gene:HCN4
Gene Synonym:SSS2
Exon (8)3138..7228
Gene:HCN4
Gene Synonym:SSS2
Translation MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA AAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGSGSSHG HLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASASCE QPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAV EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA PLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSLIPSALGSA SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSAPTPSAGVA ATTIAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPSPAPPGARGGLGLPEHFLP PPPSSRSPSSSPGQLGQPPGELSLGLATGPLSTPETPPRQPEPPSLVAGASGGASPVGFT PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT QDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGR PYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLP SNL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(63)-dbSNP:
complement(63)-g, cdbSNP:192441254
complement(410)-t, gdbSNP:140161530
complement(427)-t, gdbSNP:188896349
complement(497)-t, gdbSNP:146150604
complement(588)-g, adbSNP:183675842
complement(1030)-g, cdbSNP:201193660
complement(1042)-t, cdbSNP:376849038
complement(1101)-t, cdbSNP:143090627
complement(1522)-g, adbSNP:369418464
complement(1528)-g, adbSNP:111892410
complement(1555)-g, adbSNP:375206856
complement(1578)-g, adbSNP:201375192
complement(1581)-g, cdbSNP:200186692
complement(1655)-t, cdbSNP:371771170
complement(1736)-, tdbSNP:370245193
complement(1737)-t, cdbSNP:191744064
complement(1777)-t, gdbSNP:368583153
complement(1876)-dbSNP:
complement(1876)-g, cdbSNP:190347872
complement(1983)-g, adbSNP:370442588
complement(1984)-t, cdbSNP:146954200
complement(1988)-g, adbSNP:141185786
complement(1989)-t, cdbSNP:368164073
complement(2008)-g, cdbSNP:147771899
complement(2021)-t, cdbSNP:185719200
complement(2032)-g, adbSNP:373689222
complement(2081)-t, cdbSNP:144168042
complement(2083)-g, adbSNP:140902511
complement(2084)-t, cdbSNP:151004999
complement(2134)-t, cdbSNP:370059727
complement(2185)-g, adbSNP:142643511
complement(2236)-dbSNP:
complement(2236)-g, adbSNP:376218786
complement(2237)-t, cdbSNP:201978086
complement(2248)-g, adbSNP:373794941
complement(2350)-g, adbSNP:148453034
complement(2379)-dbSNP:
complement(2379)-t, cdbSNP:146714274
complement(2396)-t, cdbSNP:372632530
complement(2431)-g, adbSNP:202001597
2432+c, gdbSNP:121908411
complement(2437)-g, adbSNP:200337785
complement(2449)-t, cdbSNP:148875639
complement(2453)-t, cdbSNP:202037304
complement(2464)-g, adbSNP:144298603
complement(2512)-g, adbSNP:139590882
complement(2530)-g, adbSNP:146306966
complement(2552)-g, adbSNP:12909882
complement(2554)-t, cdbSNP:200033529
complement(2557)-g, adbSNP:201999732
complement(2565)-t, cdbSNP:199852438
complement(2606)-dbSNP:
complement(2606)-t, cdbSNP:375571257
complement(2629)-g, adbSNP:140015730
complement(2630)-t, cdbSNP:370884239
complement(2632)-g, adbSNP:377661468
complement(2642)-g, adbSNP:150691273
complement(2647)-t, gdbSNP:141966309
complement(2650)-g, adbSNP:148142070
2651+a, gdbSNP:104894485
complement(2659)-g, adbSNP:147075615
complement(2668)-t, gdbSNP:201337528
complement(2677)-t, gdbSNP:62641690
complement(2687)-t, cdbSNP:201811340
complement(2697)-g, cdbSNP:138714806
complement(2791)-dbSNP:
complement(2791)-t, cdbSNP:371484779
complement(2809)-t, cdbSNP:367753936
complement(2833)-g, adbSNP:117731813
complement(2834)-t, cdbSNP:201319883
complement(2889)-c, adbSNP:375986055
complement(2890)-t, cdbSNP:200737571
complement(2905)-g, adbSNP:374108859
complement(2953)-g, adbSNP:371293769
complement(2960)-t, adbSNP:377612051
complement(2990)-dbSNP:
complement(2990)-t, gdbSNP:199943122
3010+a, cdbSNP:104894488
complement(3019)-g, adbSNP:149033101
complement(3020)-t, cdbSNP:145134839
complement(3100)-g, adbSNP:200773333
complement(3103)-g, adbSNP:150378994
complement(3109)-g, adbSNP:201652877
complement(3142)-dbSNP:
complement(3142)-t, cdbSNP:376598019
complement(3175)-g, adbSNP:140354126
complement(3176)-t, cdbSNP:200468312
complement(3181)-g, cdbSNP:201156570
complement(3187)-g, adbSNP:373015590
complement(3188)-t, cdbSNP:199530458
complement(3191)-t, cdbSNP:376631391
complement(3204)-t, cdbSNP:146732972
complement(3260)-t, cdbSNP:143339036
complement(3267)-t, cdbSNP:373284500
complement(3269)-t, cdbSNP:62641689
complement(3282)-t, gdbSNP:375146815
complement(3290)-t, cdbSNP:372090359
complement(3304)-t, cdbSNP:146809501
complement(3307)-g, adbSNP:142298104
complement(3320)-t, gdbSNP:148714049
complement(3392)-g, adbSNP:181894662
complement(3393)-t, cdbSNP:375180021
complement(3414)-t, cdbSNP:200395062
complement(3436)-t, cdbSNP:369992037
complement(3456)-t, cdbSNP:144206811
complement(3459)-g, adbSNP:201143364
complement(3471)-g, adbSNP:201997521
complement(3488)-g, adbSNP:200058167
complement(3490)-c, adbSNP:139394937
complement(3511)-g, adbSNP:372150073
complement(3516)-g, adbSNP:200546024
complement(3520)-g, adbSNP:201499694
complement(3532)-t, cdbSNP:372747050
complement(3539)-c, adbSNP:202138767
complement(3550)-t, cdbSNP:117819825
complement(3585..3586)-tc, aadbSNP:71442382
complement(3595)-t, gdbSNP:143188160
complement(3598)-g, c, adbSNP:138773305
complement(3642)-g, cdbSNP:148398509
complement(3646)-g, adbSNP:373814254
complement(3651)-g, adbSNP:200575377
complement(3662)-g, adbSNP:184801511
complement(3667)-t, cdbSNP:191092709
complement(3688)-g, adbSNP:375169111
complement(3689)-t, cdbSNP:370669201
complement(3694)-t, gdbSNP:377656260
complement(3695)-t, cdbSNP:201742383
complement(3710)-t, cdbSNP:373572497
complement(3724)-t, gdbSNP:200814534
complement(3733)-t, cdbSNP:373411041
complement(3768)-g, adbSNP:375712962
complement(3794)-g, adbSNP:199638465
complement(3795)-t, cdbSNP:369485237
complement(3806)-, cdbSNP:35620549
complement(3825)-g, adbSNP:144450232
complement(3858)-g, adbSNP:371562763
complement(3898)-t, cdbSNP:368145651
complement(3911)-t, cdbSNP:200495478
complement(3931)-g, adbSNP:371549467
complement(3933)-g, cdbSNP:367719274
complement(3972)-g, adbSNP:199798661
complement(3973)-t, cdbSNP:75307879
complement(3984)-t, gdbSNP:375788137
complement(3996)-t, gdbSNP:12591469
complement(4004)-g, adbSNP:201418838
complement(4006)-t, cdbSNP:377602893
complement(4022..4023)-, cdbSNP:376127467
complement(4027)-c, adbSNP:186728422
complement(4072)-g, adbSNP:202188345
complement(4189)-g, cdbSNP:4493011
complement(4214)-g, adbSNP:200399862
complement(4282)-g, adbSNP:116042117
complement(4331)-t, cdbSNP:142735148
complement(4335)-g, adbSNP:373344096
complement(4344)-g, adbSNP:140402087
complement(4345)-t, cdbSNP:375138488
complement(4358)-, cdbSNP:35241186
complement(4390)-g, adbSNP:369224427
complement(4454)-g, adbSNP:200896834
complement(4455)-t, cdbSNP:145862018
complement(4477)-t, cdbSNP:367599490
complement(4524)-t, cdbSNP:141662311
complement(4525)-c, adbSNP:375911378
complement(4562)-t, cdbSNP:372243234
complement(4571)-g, cdbSNP:200507617
complement(4575)-g, adbSNP:147982868
complement(4576)-t, cdbSNP:375637572
complement(4577)-c, adbSNP:143431889
complement(4581)-t, cdbSNP:147181577
complement(4590)-t, adbSNP:146751122
complement(4594)-t, cdbSNP:529004
complement(4646..4649)-, aaggdbSNP:369806660
complement(4657)-g, cdbSNP:184571419
complement(4716..4717)-, ggdbSNP:201771049
complement(4717..4718)-, tgdbSNP:201885222
complement(4724..4725)-, gtdbSNP:35177144
complement(4724)-t, gdbSNP:200249977
complement(4725)-t, gdbSNP:201794707
complement(4726)-g, cdbSNP:201117747
complement(4733)-t, cdbSNP:41277726
complement(4758)-c, adbSNP:374156042
complement(4836)-c, adbSNP:192410107
complement(4962)-g, cdbSNP:187942398
complement(4981)-g, cdbSNP:183633232
complement(5020)-t, gdbSNP:3743496
complement(5065)-c, adbSNP:370649477
complement(5073)-g, adbSNP:191621714
complement(5109)-g, adbSNP:111607232
complement(5119)-t, cdbSNP:374173572
complement(5211)-t, cdbSNP:143616433
complement(5240)-g, adbSNP:138059941
complement(5271)-t, cdbSNP:73440095
complement(5308)-t, gdbSNP:199895735
complement(5308)-, adbSNP:3833037
5314+a, gdbSNP:2623999
complement(5342)-g, adbSNP:189723970
complement(5448)-t, cdbSNP:78154416
complement(5450)-t, cdbSNP:185261766
5501+a, gdbSNP:150371082
complement(5542)-t, cdbSNP:116280951
complement(5672)-t, cdbSNP:374990071
complement(5694)-t, gdbSNP:182384614
complement(5746)-t, cdbSNP:74786613
complement(5803)-g, adbSNP:117071871
complement(6061..6062)-, tdbSNP:375296948
complement(6088)-t, cdbSNP:191013007
complement(6096)-t, gdbSNP:187377882
complement(6109)-t, gdbSNP:181626404
complement(6265)-t, cdbSNP:79656991
complement(6478)-c, adbSNP:56193811
complement(6513)-t, gdbSNP:373153729
complement(6547)-c, adbSNP:370149876
complement(6595)-t, cdbSNP:549377
complement(6656)-t, cdbSNP:148078581
complement(6798)-g, adbSNP:372919497
complement(6843)-c, adbSNP:369021523
complement(6857)-g, adbSNP:143667826
complement(6886)-, gdbSNP:368549992
complement(6960)-t, cdbSNP:11631286
complement(6960)-g, adbSNP:386488798
complement(6999)-g, cdbSNP:74933243
complement(7027)-g, cdbSNP:7167434
complement(7051)-g, adbSNP:524457
complement(7142..7143)-, tdbSNP:199965428
complement(7178)-g, adbSNP:3743493
complement(7205)-t, adbSNP:60307833
complement(7206)-t, adbSNP:57100128
complement(7220)-t, adbSNP:75776477
complement(7226)-t, cdbSNP:186403235
Gene SymbolHCN4
Gene SynonymSSS2
Chromosome15
Locus Map15q24.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005477 Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 4 (HCN4), mRNA. On-demand TBD TBD
Title A HCN4+ cardiomyogenic progenitor derived from the first heart field and human pluripotent stem cells .
Author Spater D, Abramczuk MK, Buac K, Zangi L, Stachel MW, Clarke J, Sahara M, Ludwig A and Chien KR.
Journal Nat. Cell Biol. 15 (9), 1098-1106 (2013)
Title Postmortem review and genetic analysis in sudden infant death syndrome: an 11-year review .
Author Evans A, Bagnall RD, Duflou J and Semsarian C.
Journal Hum. Pathol. 44 (9), 1730-1736 (2013)
Title Molecular and functional evidence of HCN4 and caveolin-3 interaction during cardiomyocyte differentiation from human embryonic stem cells .
Author Bosman A, Sartiani L, Spinelli V, Del Lungo M, Stillitano F, Nosi D, Mugelli A, Cerbai E and Jaconi M.
Journal Stem Cells Dev. 22 (11), 1717-1727 (2013)
Title Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders .
Author den Hoed M, Eijgelsheim M, Esko T, Brundel BJ, Peal DS, Evans DM, Nolte IM, Segre AV, Holm H, Handsaker RE, Westra HJ, Johnson T, Isaacs A, Yang J, Lundby A, Zhao JH, Kim YJ, Go MJ, Almgren P, Bochud M, Boucher G, Cornelis MC, Gudbjartsson D, Hadley D, van der Harst P, Hayward C, den Heijer M, Igl W, Jackson AU, Kutalik Z, Luan J, Kemp JP, Kristiansson K, Ladenvall C, Lorentzon M, Montasser ME, Njajou OT, O'Reilly PF, Padmanabhan S, St Pourcain B, Rankinen T, Salo P, Tanaka T, Timpson NJ, Vitart V, Waite L, Wheeler W, Zhang W, Draisma HH, Feitosa MF, Kerr KF, Lind PA, Mihailov E, Onland-Moret NC, Song C, Weedon MN, Xie W, Yengo L, Absher D, Albert CM, Alonso A, Arking DE, de Bakker PI, Balkau B, Barlassina C, Benaglio P, Bis JC, Bouatia-Naji N, Brage S, Chanock SJ, Chines PS, Chung M, Darbar D, Dina C, Dorr M, Elliott P, Felix SB, Fischer K, Fuchsberger C, de Geus EJ, Goyette P, Gudnason V, Harris TB, Hartikainen AL, Havulinna AS, Heckbert SR, Hicks AA, Hofman A, Holewijn S, Hoogstra-Berends F, Hottenga JJ, Jensen MK, Johansson A, Junttila J, Kaab S, Kanon B, Ketkar S, Khaw KT, Knowles JW, Kooner AS, Kors JA, Kumari M, Milani L, Laiho P, Lakatta EG, Langenberg C, Leusink M, Liu Y, Luben RN, Lunetta KL, Lynch SN, Markus MR, Marques-Vidal P, Mateo Leach I, McArdle WL, McCarroll SA, Medland SE, Miller KA, Montgomery GW, Morrison AC, Muller-Nurasyid M, Navarro P, Nelis M, O'Connell JR, O'Donnell CJ, Ong KK, Newman AB, Peters A, Polasek O, Pouta A, Pramstaller PP, Psaty BM, Rao DC, Ring SM, Rossin EJ, Rudan D, Sanna S, Scott RA, Sehmi JS, Sharp S, Shin JT, Singleton AB, Smith AV, Soranzo N, Spector TD, Stewart C, Stringham HM, Tarasov KV, Uitterlinden AG, Vandenput L, Hwang SJ, Whitfield JB, Wijmenga C, Wild SH, Willemsen G, Wilson JF, Witteman JC, Wong A, Wong Q, Jamshidi Y, Zitting P, Boer JM, Boomsma DI, Borecki IB, van Duijn CM, Ekelund U, Forouhi NG, Froguel P, Hingorani A, Ingelsson E, Kivimaki M, Kronmal RA, Kuh D, Lind L, Martin NG, Oostra BA, Pedersen NL, Quertermous T, Rotter JI, van der Schouw YT, Verschuren WM, Walker M, Albanes D, Arnar DO, Assimes TL, Bandinelli S, Boehnke M, de Boer RA, Bouchard C, Caulfield WL, Chambers JC, Curhan G, Cusi D, Eriksson J, Ferrucci L, van Gilst WH, Glorioso N, de Graaf J, Groop L, Gyllensten U, Hsueh WC, Hu FB, Huikuri HV, Hunter DJ, Iribarren C, Isomaa B, Jarvelin MR, Jula A, Kahonen M, Kiemeney LA, van der Klauw MM, Kooner JS, Kraft P, Iacoviello L, Lehtimaki T, Lokki ML, Mitchell BD, Navis G, Nieminen MS, Ohlsson C, Poulter NR, Qi L, Raitakari OT, Rimm EB, Rioux JD, Rizzi F, Rudan I, Salomaa V, Sever PS, Shields DC, Shuldiner AR, Sinisalo J, Stanton AV, Stolk RP, Strachan DP, Tardif JC, Thorsteinsdottir U, Tuomilehto J, van Veldhuisen DJ, Virtamo J, Viikari J, Vollenweider P, Waeber G, Widen E, Cho YS, Olsen JV, Visscher PM, Willer C, Franke L, Erdmann J, Thompson JR, Pfeufer A, Sotoodehnia N, Newton-Cheh C, Ellinor PT, Stricker BH, Metspalu A, Perola M, Beckmann JS, Smith GD, Stefansson K, Wareham NJ, Munroe PB, Sibon OC, Milan DJ, Snieder H, Samani NJ and Loos RJ.
Journal Nat. Genet. 45 (6), 621-631 (2013)
Title Local and global interpretations of a disease-causing mutation near the ligand entry path in hyperpolarization-activated cAMP-gated channel .
Author Xu X, Marni F, Wu S, Su Z, Musayev F, Shrestha S, Xie C, Gao W, Liu
Journal Structure 20 (12), 2116-2123 (2012)
Title Functional comparison of HCN isoforms expressed in ventricular and .
Author Qu J, Altomare C, Bucchi A, DiFrancesco D and Robinson RB.
Journal Pflugers Arch. 444 (5), 597-601 (2002)
Title Hyperpolarization-activated channels HCN1 and HCN4 mediate responses to sour stimuli .
Author Stevens DR, Seifert R, Bufe B, Muller F, Kremmer E, Gauss R, Meyerhof W, Kaupp UB and Lindemann B.
Journal Nature 413 (6856), 631-635 (2001)
Title Molecular characterization of a slowly gating human hyperpolarization-activated channel predominantly expressed in thalamus, heart, and testis .
Author Seifert R, Scholten A, Gauss R, Mincheva A, Lichter P and Kaupp UB.
Journal Proc. Natl. Acad. Sci. U.S.A. 96 (16), 9391-9396 (1999)
Title Two pacemaker channels from human heart with profoundly different activation kinetics .
Author Ludwig A, Zong X, Stieber J, Hullin R, Hofmann F and Biel M.
Journal EMBO J. 18 (9), 2323-2329 (1999)
Title Brugada Syndrome .
Author Brugada,R., Campuzano,O., Brugada,P., Brugada,J. and Hong,K.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.