• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class K (PIGK), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu04946 Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class K (PIGK), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu04946C Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class K (PIGK), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_005482.2, 110224470
Length 1188 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class K (PIGK), mRNA.
Product GPI-anchor transamidase precursor
Comment

Summary: This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq, Jul 2008].

RefSeq NP_005473.1
CDS 46..1233
Misc Feature(1)169..1038
Misc Feature(2)976..1008
Misc Feature(3)1147..1209
Exon (1)1..138
Gene:PIGK
Gene Synonym:GPI8
Exon (2)139..192
Gene:PIGK
Gene Synonym:GPI8
Exon (3)193..284
Gene:PIGK
Gene Synonym:GPI8
Exon (4)285..420
Gene:PIGK
Gene Synonym:GPI8
Exon (5)421..532
Gene:PIGK
Gene Synonym:GPI8
Exon (6)533..629
Gene:PIGK
Gene Synonym:GPI8
Exon (7)630..747
Gene:PIGK
Gene Synonym:GPI8
Exon (8)748..858
Gene:PIGK
Gene Synonym:GPI8
Exon (9)859..1031
Gene:PIGK
Gene Synonym:GPI8
Exon (10)1032..1116
Gene:PIGK
Gene Synonym:GPI8
Exon (11)1117..4626
Gene:PIGK
Gene Synonym:GPI8
Translation MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYR HVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVD YRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPA IGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLI TDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPK LKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(44)-dbSNP:
complement(44)-t, adbSNP:146101175
complement(66)-g, adbSNP:141881551
complement(83)-g, adbSNP:138493120
complement(90)-t, cdbSNP:141867794
complement(91)-t, cdbSNP:12723684
complement(118)-t, cdbSNP:377457719
complement(124)-t, cdbSNP:149699790
complement(151)-dbSNP:
complement(151)-t, gdbSNP:189968569
complement(196)-dbSNP:
complement(196)-c, adbSNP:368624830
complement(205)-g, adbSNP:202176006
complement(206)-t, cdbSNP:146489857
complement(228)-c, adbSNP:201652469
complement(271)-t, cdbSNP:150809384
complement(279)-g, adbSNP:148725038
complement(317)-dbSNP:
complement(317)-g, cdbSNP:373820468
complement(345)-t, adbSNP:187961781
417+c, tdbSNP:1779199
complement(442)-dbSNP:
complement(442)-g, adbSNP:374050300
complement(443)-t, cdbSNP:147088906
complement(467)-g, adbSNP:114260507
complement(474)-t, adbSNP:376757308
complement(488)-t, cdbSNP:188063187
complement(570)-dbSNP:
complement(570)-g, adbSNP:113056847
complement(594)-g, adbSNP:375614948
complement(595)-t, cdbSNP:201690868
complement(597)-t, cdbSNP:17099989
complement(628)-g, adbSNP:151148520
complement(656)-dbSNP:
complement(656)-t, adbSNP:373393953
complement(672)-t, cdbSNP:140910554
complement(676)-t, cdbSNP:144038716
complement(686)-t, cdbSNP:140360373
complement(693)-g, adbSNP:139604872
complement(706)-t, cdbSNP:61755360
complement(712)-g, cdbSNP:369037070
complement(744)-t, cdbSNP:35968680
complement(747)-t, cdbSNP:142473240
complement(820)-dbSNP:
complement(820)-t, cdbSNP:200133111
complement(865)-dbSNP:
complement(865)-c, adbSNP:373074286
complement(877)-t, gdbSNP:200092834
complement(910)-g, cdbSNP:369954648
complement(913)-t, gdbSNP:367851700
complement(928)-g, adbSNP:200864553
complement(930..931)-, tdbSNP:34507841
complement(967)-g, adbSNP:139868827
complement(1014)-t, cdbSNP:200590835
complement(1061)-dbSNP:
complement(1061)-c, adbSNP:192818073
complement(1072)-g, adbSNP:143091850
complement(1080)-g, adbSNP:200283917
complement(1192)-dbSNP:
complement(1192)-g, adbSNP:113367396
1235+c, gdbSNP:1048575
complement(1365)-g, adbSNP:375977397
complement(1401)-t, cdbSNP:115725690
complement(1426)-t, cdbSNP:115723718
complement(1621)-g, adbSNP:180724603
1653+a, cdbSNP:1802047
complement(1656)-t, cdbSNP:189754460
complement(1663)-t, cdbSNP:72681880
1709+a, cdbSNP:1802046
complement(1791)-c, adbSNP:372751352
complement(1792)-c, adbSNP:111483433
complement(1807)-g, adbSNP:185288928
complement(1953)-g, adbSNP:12035349
complement(1994)-t, adbSNP:181196555
complement(2051)-t, cdbSNP:145723599
complement(2077)-g, adbSNP:368827106
complement(2223)-t, cdbSNP:375762147
complement(2260)-g, adbSNP:111659867
complement(2287)-t, cdbSNP:188717737
complement(2441)-t, cdbSNP:185116205
complement(2525)-t, adbSNP:1056040
complement(2526)-t, adbSNP:7544099
complement(2528)-, tdbSNP:199817747
complement(2656)-t, adbSNP:182076687
complement(2709)-t, gdbSNP:190267329
complement(2867)-t, adbSNP:74679527
complement(2951)-g, cdbSNP:185741762
complement(2985)-c, adbSNP:140327777
complement(3209)-g, adbSNP:146731179
complement(3273)-t, cdbSNP:142198027
complement(3274)-t, gdbSNP:149112772
complement(3364)-t, gdbSNP:145142877
complement(3549)-t, cdbSNP:191260677
complement(3555)-t, cdbSNP:11162270
complement(3585)-g, adbSNP:368178454
complement(3617)-t, cdbSNP:139483805
complement(3744)-g, adbSNP:370208778
complement(3755)-c, adbSNP:186800017
complement(3811)-t, cdbSNP:169216
complement(3811)-t, cdbSNP:386494617
complement(3881)-c, adbSNP:183961822
complement(3918)-t, adbSNP:191745435
complement(4150)-g, adbSNP:188378289
complement(4234)-t, adbSNP:183319308
complement(4253)-t, adbSNP:150976375
complement(4258)-t, gdbSNP:115728301
complement(4409..4410)-, tdbSNP:34903911
complement(4517)-g, adbSNP:17099885
Gene SymbolPIGK
Gene SynonymGPI8
Chromosome1
Locus Map1p31.1
Title A single nucleotide polymorphism in the human PIGK gene associates with low PIGK expression in colorectal cancer patients .
Author Dasgupta S, Pal P, Mukhopadhyay ND, Fu Y, Ratovitski EA, Moon CS, Hoque MO, Fisher PB and Trink B.
Journal Int. J. Oncol. 41 (4), 1405-1410 (2012)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)
Title Human PIG-U and yeast Cdc91p are the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins .
Author Hong Y, Ohishi K, Kang JY, Tanaka S, Inoue N, Nishimura J, Maeda Y and Kinoshita T.
Journal Mol. Biol. Cell 14 (5), 1780-1789 (2003)
Title Two subunits of glycosylphosphatidylinositol transamidase, GPI8 and PIG-T, form a functionally important intermolecular disulfide bridge .
Author Ohishi K, Nagamune K, Maeda Y and Kinoshita T.
Journal J. Biol. Chem. 278 (16), 13959-13967 (2003)
Title Proprotein interaction with the GPI transamidase .
Author Chen R, Anderson V, Hiroi Y and Medof ME.
Journal J. Cell. Biochem. 88 (5), 1025-1037 (2003)
Title Gaa1p and gpi8p are components of a glycosylphosphatidylinositol (GPI) transamidase that mediates attachment of GPI to proteins .
Author Ohishi K, Inoue N, Maeda Y, Takeda J, Riezman H and Kinoshita T.
Journal Mol. Biol. Cell 11 (5), 1523-1533 (2000)
Title Active site determination of Gpi8p, a caspase-related enzyme required for glycosylphosphatidylinositol anchor addition to proteins .
Author Meyer U, Benghezal M, Imhof I and Conzelmann A.
Journal Biochemistry 39 (12), 3461-3471 (2000)
Title The affected gene underlying the class K glycosylphosphatidylinositol (GPI) surface protein defect codes for the GPI transamidase .
Author Yu J, Nagarajan S, Knez JJ, Udenfriend S, Chen R and Medof ME.
Journal Proc. Natl. Acad. Sci. U.S.A. 94 (23), 12580-12585 (1997)
Title Yeast Gpi8p is essential for GPI anchor attachment onto proteins .
Author Benghezal M, Benachour A, Rusconi S, Aebi M and Conzelmann A.
Journal EMBO J. 15 (23), 6575-6583 (1996)
Title Cellular receptor for urokinase plasminogen activator. Carboxyl-terminal processing and membrane anchoring by glycosyl-phosphatidylinositol .
Author Ploug M, Ronne E, Behrendt N, Jensen AL, Blasi F and Dano K.
Journal J. Biol. Chem. 266 (3), 1926-1933 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.