• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 6B (KRT6B), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_005555 Homo sapiens keratin 6B (KRT6B), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_005555.3, 119703752
Length 2331 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 6B (KRT6B), mRNA.
Product keratin, type II cytoskeletal 6B
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. Mutations in these genes have been associated with pachyonychia congenita. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC034535.1, L42612.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_005546.2
CDS 49..1743
Misc Feature(1)25..27
Misc Feature(2)25..27
Misc Feature(3)52..534
Misc Feature(4)52..534
Misc Feature(5)52..54
Misc Feature(6)532..1473
Misc Feature(7)535..1464
Misc Feature(8)535..642
Misc Feature(9)643..699
Misc Feature(10)700..975
Misc Feature(11)976..1047
Misc Feature(12)1048..1464
Misc Feature(13)1288..1290
Misc Feature(14)1465..1740
Exon (1)1..588
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (2)589..803
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (3)804..864
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (4)865..960
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (5)961..1125
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (6)1126..1251
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (7)1252..1472
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (8)1473..1507
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Exon (9)1508..2282
Gene:KRT6B
Gene Synonym:CK-6B; CK6B; K6B; KRTL1; PC2
Translation MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRS LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDK VRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDNIVGERGRLDSELR NMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY EELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLS SVGGGSSTIKYTTTSSSSRKSYKH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-t, gdbSNP:426977
complement(30)-g, adbSNP:451006
complement(71)-t, adbSNP:200240023
complement(109)-t, cdbSNP:201864717
complement(110)-g, adbSNP:428894
complement(154)-g, adbSNP:404970
complement(167)-t, cdbSNP:139304263
complement(174)-t, cdbSNP:150268236
complement(195)-t, cdbSNP:445185
complement(205)-t, cdbSNP:201156749
complement(246)-t, gdbSNP:141114189
complement(310)-t, cdbSNP:201122967
complement(333)-g, adbSNP:148190092
complement(337)-t, cdbSNP:144860693
complement(380)-t, cdbSNP:140878617
complement(421)-g, adbSNP:202222264
complement(425)-t, cdbSNP:146454705
complement(465)-g, adbSNP:200768134
complement(476)-t, cdbSNP:80158424
complement(510)-g, adbSNP:145409385
complement(511)-t, cdbSNP:1701772
complement(539)-t, cdbSNP:140336962
complement(540)-t, adbSNP:145590668
complement(543)-t, cdbSNP:199847801
complement(564..566)-, caadbSNP:267607472
complement(567)-t, cdbSNP:149739313
complement(593)-dbSNP:
complement(593)-t, cdbSNP:71453293
complement(605)-t, cdbSNP:151027332
complement(615)-g, cdbSNP:150221772
complement(635)-g, adbSNP:139925091
complement(657)-g, adbSNP:147485252
complement(683)-g, adbSNP:11170126
complement(684)-t, cdbSNP:143150216
complement(691)-t, cdbSNP:201956073
complement(728)-g, adbSNP:652423
complement(735)-g, cdbSNP:71453292
complement(747)-g, adbSNP:28542657
complement(750)-g, adbSNP:28414881
complement(759)-t, cdbSNP:149632179
complement(793)-g, adbSNP:138341104
complement(844)-dbSNP:
complement(844)-t, cdbSNP:150075508
complement(867)-dbSNP:
complement(867)-g, adbSNP:150034493
complement(875)-g, adbSNP:137905665
complement(876)-c, adbSNP:145344532
complement(883)-t, adbSNP:140303040
complement(889)-t, gdbSNP:151191247
complement(890)-t, adbSNP:143139505
complement(892)-c, adbSNP:149104415
complement(913)-t, cdbSNP:200532105
complement(921)-t, cdbSNP:382894
complement(982)-dbSNP:
complement(982)-g, adbSNP:142625176
complement(1012)-t, cdbSNP:145091946
complement(1024)-g, adbSNP:190319305
complement(1037)-g, adbSNP:145327282
complement(1093)-t, gdbSNP:11503946
complement(1141)-dbSNP:
complement(1141)-g, adbSNP:437014
complement(1234)-t, cdbSNP:138988810
complement(1239)-g, adbSNP:146904435
complement(1246)-t, cdbSNP:139792514
complement(1263)-dbSNP:
complement(1263)-g, adbSNP:1132957
complement(1269)-g, adbSNP:388626
complement(1270)-t, cdbSNP:141947025
complement(1292)-t, cdbSNP:200778388
complement(1305)-t, gdbSNP:202113612
complement(1322)-t, cdbSNP:190534022
complement(1356)-t, cdbSNP:142940927
complement(1361)-t, cdbSNP:146391553
complement(1362)-t, cdbSNP:142297644
complement(1369)-g, cdbSNP:137872925
complement(1375)-g, adbSNP:199727604
complement(1407)-g, adbSNP:145280284
complement(1408)-t, cdbSNP:141597595
complement(1429)-g, adbSNP:267607473
complement(1444)-g, adbSNP:138479175
complement(1459)-c, adbSNP:150128167
complement(1462)-g, adbSNP:60627726
complement(1489)-dbSNP:
complement(1489)-t, cdbSNP:140834481
complement(1515)-dbSNP:
complement(1515)-t, cdbSNP:148044538
complement(1515)-g, adbSNP:11540295
complement(1524)-g, adbSNP:201073484
complement(1525)-t, cdbSNP:147008947
complement(1525)-g, adbSNP:11540297
complement(1538)-t, cdbSNP:61746354
complement(1542)-g, adbSNP:147867894
complement(1543)-t, cdbSNP:61746355
complement(1552)-t, cdbSNP:149152547
complement(1557)-g, adbSNP:145254155
complement(1558)-t, cdbSNP:150021015
complement(1571)-t, cdbSNP:139358472
complement(1590)-g, adbSNP:146373607
complement(1596)-g, adbSNP:61749468
complement(1597)-g, adbSNP:200055232
complement(1614)-g, adbSNP:140188440
complement(1615)-t, cdbSNP:146173634
complement(1619)-t, cdbSNP:141150690
complement(1641)-t, gdbSNP:148209422
complement(1642)-t, cdbSNP:143946299
complement(1657)-t, cdbSNP:149495966
complement(1673)-g, adbSNP:138021918
complement(1681)-t, cdbSNP:146988096
complement(1685)-t, cdbSNP:145923896
complement(1688)-g, cdbSNP:141409814
complement(1713)-g, adbSNP:138933209
complement(1715)-g, adbSNP:200620417
complement(1753)-t, cdbSNP:200690379
complement(1853)-g, cdbSNP:75893729
complement(2162)-g, adbSNP:116436520
complement(2166)-t, gdbSNP:73308613
complement(2270)-g, adbSNP:187031962
Gene SymbolKRT6B
Gene SynonymCK-6B; CK6B; K6B; KRTL1; PC2
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005555 Homo sapiens keratin 6B (KRT6B), mRNA. In-stock $509.00 $460.00 12
Title A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita .
Author Eliason,M.J., Leachman,S.A., Feng,B.J., Schwartz,M.E. and Hansen,C.D.
Journal J. Am. Acad. Dermatol. 67 (4), 680-686 (2012)
Title The diagnostic utility of D2-40, calretinin, CK5/6, desmin and MOC-31 in the differentiation of mesothelioma from adenocarcinoma in pleural effusion cytology .
Author Hyun,T.S., Barnes,M. and Tabatabai,Z.L.
Journal Acta Cytol. 56 (5), 527-532 (2012)
Title Prediction of local recurrence, distant metastases, and death after breast-conserving therapy in early-stage invasive breast cancer using a five-biomarker panel .
Author Millar,E.K., Graham,P.H., O'Toole,S.A., McNeil,C.M., Browne,L., Morey,A.L., Eggleton,S., Beretov,J., Theocharous,C., Capp,A., Nasser,E., Kearsley,J.H., Delaney,G., Papadatos,G., Fox,C. and Sutherland,R.L.
Journal J. Clin. Oncol. 27 (28), 4701-4708 (2009)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer,J., Bowden,P.E., Coulombe,P.A., Langbein,L., Lane,E.B., Magin,T.M., Maltais,L., Omary,M.B., Parry,D.A., Rogers,M.A. and Wright,M.W.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms .
Author Takahashi,K., Paladini,R.D. and Coulombe,P.A.
Journal J. Biol. Chem. 270 (31), 18581-18592 (1995)
Title Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes .
Author Rasmussen,H.H., van Damme,J., Puype,M., Gesser,B., Celis,J.E. and Vandekerckhove,J.
Journal Electrophoresis 13 (12), 960-969 (1992)
Title Squamous cell carcinomas, an immunohistochemical and ultrastructural study .
Author Suo,Z., Holm,R. and Nesland,J.M.
Journal Anticancer Res. 12 (6B), 2025-2031 (1992)
Title Three epidermal and one simple epithelial type II keratin genes map to human chromosome 12 .
Author Rosenberg,M., Fuchs,E., Le Beau,M.M., Eddy,R.L. and Shows,T.B.
Journal Cytogenet. Cell Genet. 57 (1), 33-38 (1991)
Title Two type II keratin genes are localized on human chromosome 12 .
Author Popescu,N.C., Bowden,P.E. and DiPaolo,J.A.
Journal Hum. Genet. 82 (2), 109-112 (1989)
Title The sequence of a type II keratin gene expressed in human skin: conservation of structure among all intermediate filament genes .
Author Tyner,A.L., Eichman,M.J. and Fuchs,E.
Journal Proc. Natl. Acad. Sci. U.S.A. 82 (14), 4683-4687 (1985)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.